Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides  >>  Anti-BetaGamma (MPS-Phosducin-like protein C terminus)

Product Name Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Size 1 mg
Catalog # AS-24178
US$ $435
Description

This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβϒ-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins.

Detailed Information Datasheet
Storage -20C
References 1, Orr, A. et al. J. Biol. Chem. 277, 20453 (2002)
2, Chang M. et al. J Biol Chem. 275:7021-7029 (2000).
Molecular Weight 4601.4
Sequence
(One-Letter Code)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Sequence
(Three-Letter Code)
H - Ala - Ala - Val - Ala - Leu - Leu - Pro - Ala - Val - Leu - Leu - Ala - Leu - Leu - Ala - Val - Thr - Asp - Gln - Leu - Gly - Glu - Asp - Phe - Phe - Ala - Val - Asp - Leu - Glu - Ala - Phe - Leu - Gln - Glu - Phe - Gly - Leu - Leu - Pro - Glu - Lys - Glu - OH
Product Citations Morrey, C. et al. (2008). Cardioprotective effect of histamine H3-receptor activation: pivotal role of Gβγ-dependent inhibition of voltage-operated Ca2+ channels. J Pharmacol Exp Ther326, 871. doi: 10.1124/jpet.108.137919.
Carlos, Talaia. et al. (2005). Interaction between adenosine A2B- receptors and α2-adrenoreceptors on the modulation of noradrenalin release in the rat vas deferens: Possible involvement of a group 2 adenylyl cyclase isoform. Neurochem Intl476, 418-429. doi: doi:10.1016/j.neuint.2005.05.013.
Orr, A. et al. (2002). Thrombospondin Stimulates Focal Adhesion Disassembly through Gi- and Phosphoinositide 3-Kinase-dependent ERK Activation. J Biol Chem. 277, 20453. doi: 10.1074/jbc.M112091200.
     
  < Back