Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled, Human

Product Name Beta - Amyloid (1 - 40), HiLyte™ Fluor 488 - labeled, Human
HiLyte™ Fluor 488 - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # 60491-01
US$ $220
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (HiLyte™ Fluor 488)-labeled ß-Amyloid peptide, Abs/Em=503/528 nm.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Brochure
Storage -20°C
Molecular Weight 4686.3
Sequence
(One-Letter Code)
HiLyte™ Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
Hilyte™ Fluor 488 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Caglayan, S. et al. (2014). Lysosomal Sorting of Amyloid-β by the SORLA Receptor Is Impaired by a Familial Alzheimer’s Disease Mutation. Sci Transl Med 6, 223ra20. doi: 10.1126/scitranslmed.3007747 .
Carlo, A-S. et al. (2013). The pro-neurotrophin receptor Sortilin is a major neuronal apolipoprotein E receptor for catabolism of amyloid-β peptide in the brain. J Neurosci 33, 358. doi: 10.1523/​JNEUROSCI.2425-12.2013.
Anderson, VL. & WW. Webb (2011). Transmission electron microscopy characterization of fluorescently labelled amyloid β 1-40 and α-synuclein aggregates. BMC Biotechnol 11, 125. doi:10.1186/1472-6750-11-125.
Hamada, T. (2010). Biomimetic Microdroplet Membrane Interface: Detection of the Lateral Localization of Amyloid Beta Peptides. J Phys Chem Lett 1, 170.
Ding, H. et al. (2009). Determination of the Oligomer Size of Amyloidogenic Protein β-Amyloid(1–40) by Single-Molecule Spectroscopy. Biophys J 97, 912.
Meier, M. et al. (2009). Plug-based microfluidics with defined surface chemistry to miniaturize and control aggregation of amyloidogenic peptides. Angew Chem Int Ed 48, 1.
Morita, M. et al. (2009). Real-time observation of model membrane dynamics induced by Alzheimer's amyloid beta. Biophys Chem 147, 81.
Petersen, CAH. et al. (2008). The amyloid β-peptide is imported into mitochondria via the TOM import machinery and localized to mitochondrial cristae. PNAS 105, 13145.
     
  < Back