Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (1-42), Scrambled, 5-FAM labeled, Human

Product Name Beta - Amyloid (1 - 42), Scrambled, 5 - FAM labeled, Human
5 - FAM - AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Size 0.1 mg
Catalog # 60892
US$ $237
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4873.4
Sequence
(One-Letter Code)
5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence
(Three-Letter Code)
5 - FAM - Ala - Ile - Ala - Glu - Gly - Asp - Ser - His - Val - Leu - Lys - Glu - Gly - Ala - Tyr - Met - Glu - Ile - Phe - Asp - Val - Gln - Gly - His - Val - Phe - Gly - Gly - Lys - Ile - Phe - Arg - Val - Val - Asp - Leu - Gly - Ser - His - Asn - Val - Ala - OH
Product Citations Shaked, BM. The FASEB Journal. 208, 1254 (2006).
     
  < Back