Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (11-42), HiLyte™ Fluor 488-labeled, Human

Product Name Beta - Amyloid (11 - 42), HiLyte™ Fluor 488 - labeled, Human
HiLyte™ Fluor 488 - EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 0.1 mg
Catalog # 63327
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Huse, J. T. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002).
Molecular Weight 3692.3
Sequence
(One-Letter Code)
HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
Hilyte™ Fluor 488 - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Hickman, S. et al. J Neurosci 28, 8354 (2008).
     
  < Back