Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Glucagon (1-29), bovine, human, porcine, FAM-labeled

Product Name Glucagon (1 - 29), bovine, human, porcine, FAM - labeled
FAM - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Size 0.5 mg
Catalog # AS-60273-05
US$ $143
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References O'Harte. FP. et. al. Mol Cell Endocrinol 381, 26 (2013), doi: 10.1016/j.mce.2013.07.014
Drucker DJ. Endocrinology: Adult and Pediatric (7th Ed.) 1, 586 (2016), doi:10.1016/B978-0-323-18907-1.00034-2
Molecular Weight 3841.1
Sequence
(One-Letter Code)
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Sequence
(Three-Letter Code)
FAM - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - OH
     
  < Back