Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides  >>  TAT-HA2 Fusion Peptide

Product Name TAT - HA2 Fusion Peptide
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Size 1 mg
Catalog # 64876
US$ $215
Description

This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.

Storage -20C
References Wadia, J. et al. Nature Med 10, 310 (2004).
Molecular Weight 3433
Sequence
(One-Letter Code)
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Sequence
(Three-Letter Code)
H - Arg - Arg - Arg - Gln - Arg - Arg - Lys - Lys - Arg - Gly - Gly - Asp - Ile - Met - Gly - Glu - Trp - Gly - Asn - Glu - Ile - Phe - Gly - Ala - Ile - Ala - Gly - Phe - Leu - Gly - OH
     
  < Back