Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (1-28)-Lys(HiLyte™ Fluor 488), Human

Product Name Beta - Amyloid (1 - 28) - Lys(HiLyte™ Fluor 488), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNK - K(HiLyte™ Fluor 488)
Size 0.1 mg
Catalog # 60982
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 3747.0
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(HiLyte™ Fluor 488)
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Lys(Hilyte™ Fluor 488) - OH
     
  < Back