Peptides  >  GPCR Peptide Ligands  >  Calcitonin
 Product Size Catalog # US$  
Biotin - Calcitonin, human
Biotin - CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
0.5 mg 23580 $303
Calcitonin N - Terminal Flanking Peptide, human, N - Procalcitonin
1 mg 20680 $577
Calcitonin, human
1 mg 20673 $137
Calcitonin, human
5 mg 20674 $577
Calcitonin, rat
5 mg 24205 $577
Calcitonin, salmon
1 mg 20677 $121
Calcitonin, salmon
5 mg 20678 $484
  < Back