Peptides  >  GPCR Peptide Ligands  >  Gastrin
 Product Size Catalog # US$  
(Leu15) - Gastrin - 1, human
Pyr - GPWLEEEEEAYGWLDF - NH2
1 mg AS-64149 $105
Big Gastrin - 1, human
Pyr - LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF - NH2
0.5 mg AS-20747 $259
Biotin - Gastrin (1 - 17)
Biotin - EGPWLEEEEEAYGWMDF - NH2
1 mg AS-60329-1 $143
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM - NH2
0.5 mg AS-24213 $115
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM - NH2
1 mg AS-24214 $193
Gastrin - 1, human
Pyr - GPWLEEEEEAYGWMDF - NH2
1 mg AS-20750 $127
Gastrin - 1, rat
Pyr - RPPMEEEEEAYGWMDF - NH2
1 mg AS-20752 $127
Leptin (93 - 105), human
NVIQISNDLENLR
1 mg AS-62853 $83
Xenin
MLTKFETKSARVKGLSFHPKRPWIL
0.5 mg AS-60753 $110
  < Back