Peptides  >  GPCR Peptide Ligands  >  Adrenomedullin
 Product Size Catalog # US$  
Adrenomedullin (1 - 52), human
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY - NH2 (Disulfide bridge: 16 - 21)
0.5 mg AS-60447 $335
Adrenomedullin (22 - 52), human
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY - NH2
0.5 mg AS-60449 $181
  < Back