Peptides  >  GPCR Peptide Ligands  >  CGRP
 Product Size Catalog # US$  
α - Calcitonin Gene Related Peptide, α - CGRP, rat
SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2 (Disulfide bridge: 2 - 7)
1 mg 60730 $259
β - CGRP, human
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
0.5 mg 64563-05 $198
β - CGRP, human
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
1 mg 64563-1 $330
Biotin - a - CGRP, human
Biotin - LC - ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge:2 - 7)
1 mg 64564-1 $750
Calcitonin Gene Related Peptide, CGRP (8 - 37), human
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2
1 mg 22857 $215
Calcitonin Gene Related Peptide, CGRP (8 - 37), rat
VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF - NH2
1 mg 62956 $237
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)
0.5 mg 20681 $154
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF - NH2 (Disulfide bridge: 2 - 7)
1 mg 20682 $259
  < Back