Peptides  >  GPCR Peptide Ligands  >  Galanin
 Product Size Catalog # US$  
Biotin - Galanin, human
Biotin - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Biotin - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
0.5 mg 23582 $181
Biotin - Galanin, human
Biotin - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Biotin - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg 23583 $303
Galanin (1 - 13) - Bradykinin (2 - 9), amide, M35
GWTLNSAGYLLGPPPGFSPFR - NH2
GWTLNSAGYLLGPPPGFSPFR - NH2
1 mg 22439 $165
Galanin (1 - 13) - Pro - Pro - (Ala - Leu)2 - Ala, amide
GWTLNSAGYLLGPPPALALA - NH2
GWTLNSAGYLLGPPPALALA - NH2
0.5 mg 22440 $121
Galanin Like Peptide (GALP) N - terminal fragment, porcine
APVHRGRGGWTLNSAGYLLGPVLHPPSRAE
APVHRGRGGWTLNSAGYLLGPVLHPPSRAE
1 mg 61850-05 $143
Galanin Like Peptide, GALP (41 - 60), human, porcine, rat
ILDLWKAIDGLPYSRSPRMT
ILDLWKAIDGLPYSRSPRMT
1 mg 61848 $121
Galanin, human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
0.5 mg 22430 $137
Galanin, human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg 22431 $237
Galanin, human, FAM - labeled
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg 23603 $423
Galanin, rat
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2
0.5 mg 22434 $154
Galanin, rat
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2
1 mg 22435 $275
Galanin - Lys(Biotin), human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
0.5 mg 23638 $253
Galanin - Lys(Biotin), human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
1 mg 23639 $423
Galanin - Lys(Biotin), human, FAM - labeled
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
0.5 mg 23620 $253
Galanin - Lys(Biotin), human, FAM - labeled
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
1 mg 23621 $423
  < Back