Peptides  >  GPCR Peptide Ligands  >  Galanin
 Product Size Catalog # US$  
Biotin - Galanin, human
Biotin - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg AS-23583 $303
Galanin (1 - 13) - Bradykinin (2 - 9), amide, M35
GWTLNSAGYLLGPPPGFSPFR - NH2
1 mg AS-22439 $165
Galanin, human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
0.5 mg AS-22430 $137
Galanin, human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg AS-22431 $237
Galanin, human, FAM - labeled
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg AS-23603 $423
Galanin, rat
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2
0.5 mg AS-22434 $154
Galanin, rat
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2
1 mg AS-22435 $275
Galanin - Lys(Biotin), human, FAM - labeled
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
0.5 mg AS-23620 $253
Galanin - Lys(Biotin), human, FAM - labeled
FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
1 mg AS-23621 $423
  < Back