Peptides  >  GPCR Peptide Ligands  >  Endothelin
 Product Size Catalog # US$  
Big Endothelin 1 (1 - 39), porcine
CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-20715 $583
Big Endothelin - 1 (1 - 38), human
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-62946-1 $605
Big Endothelin - 1 (1 - 38), human
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-62946-05 $363
Endothelin 1, human, FAM - labeled
FAM - CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-27116 $605
Endothelin 1, human, HiLyte™ Fluor 488 - labeled
HiLyte™ Fluor 488 - CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1 - 15 and 3 - 11)
0.25 mg AS-64817-025 $413
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.25 mg AS-22859 $181
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-22860 $291
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-22861 $462
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-24323 $193
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-24324 $341
  < Back