Peptides  >  GPCR Peptide Ligands  >  Neuromedin
 Product Size Catalog # US$  
Neuromedin (B - 30)
LSWDLPEPRSRAGKIRVHPRGNLWATGHFM - NH2
5 mg 23039 $1007
Neuromedin N
KIPYIL
25 mg 23052 $347
  < Back