Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides
 Product Size Catalog # US$  
α - Calcitonin Gene Related Peptide, α - CGRP, rat
1 mg AS-60730 $259
ω - Conotoxin MVIIA
CKGKGAKCSRLMYDCCTGSCRSGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20, and 15 - 25)
0.5 mg AS-20579 $363
ω - Conotoxin MVIIA
CKGKGAKCSRLMYDCCTGSCRSGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20, and 15 - 25)
1 mg AS-27057 $665
ω - Conotoxin MVIIC
CKGKGAPCRKTMYDCCSGSCGRRGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20,and 15 - 26)
0.1 mg AS-20580 $143
ω - Conotoxin MVIIC
CKGKGAPCRKTMYDCCSGSCGRRGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20,and 15 - 26)
0.5 mg AS-27058 $583
[Arg8] - Vasopressin (AVP)
CYFQNCPRG - NH2 (Disulfide bridge: 1 - 6)
1 mg AS-24289 $33
[Arg8] - Vasopressin (AVP)
CYFQNCPRG - NH2 (Disulfide bridge: 1 - 6)
5 mg AS-24290 $127
[Glu32] - Charybdotoxin
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKECRCYS (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
0.1 mg AS-61200-01 $143
[Tyr1] - Somatostatin 14
YGCKNFFWKTFTSC (Disulfide bridge: 3 - 14)
1 mg AS-22899 $55
Adrenomedullin (1 - 52), human
0.5 mg AS-60447 $335
AGRP fragment (83 - 132), amide
0.1 mg AS-27124 $457
Aminopeptidase N Ligand (CD13), NGR peptide
CNGRCG (Disulfide bridge: 1 - 5)
5 mg AS-60171-5 $484
Amylin (1 - 37), human
1 mg AS-60804 $303
Amylin (1 - 37), human, amide
1 mg AS-60254-1 $240
Amylin (1 - 37), rat
0.5 mg AS-60253-05 $303
Amylin (1 - 37), rat
1 mg AS-60253-1 $479
CNCKAPETALCARRCQQH - NH2 (Disulfide bridge: 1 - 11; 3 - 15)
0.5 mg AS-60772 $115
Atrial Natriuretic Peptide (1 - 28), human, porcine
0.5 mg AS-20647 $121
Atrial Natriuretic Peptide (1 - 28), human, porcine
1 mg AS-20648 $145
Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
0.5 mg AS-23972 $181
Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
1 mg AS-23973 $303
Atrial Natriuretic Peptide (1 - 28), rat
0.5 mg AS-20651 $121
Atrial Natriuretic Peptide (1 - 28), rat
1 mg AS-20652 $150
Atrial Natriuretic Peptide (4 - 18), rat
RSSCFGGRIDRIGAC - NH2 (Disulfide bridge 4 - 15)
1 mg AS-62839 $143
Bactenecin, bovine
RLCRIVVIRVCR (Disulfide bridge: 3 - 11)
0.5 mg AS-61066 $176
Big Endothelin 1 (1 - 39), porcine
1 mg AS-20715 $583
Big Endothelin - 1 (1 - 38), human
0.5 mg AS-62946-05 $363
Big Endothelin - 1 (1 - 38), human
1 mg AS-62946-1 $605
Biotin - Calcitonin, human
Biotin - CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
0.5 mg AS-23580 $303
Biotin - Oxytocin
Biotin - CYIQNCPLG - NH2 (Disulfide bridge: 1 - 6)
1 mg AS-23994 $203
Biotin - Oxytocin
Biotin - CYIQNCPLG - NH2 (Disulfide bridge: 1 - 6)
5 mg AS-23995 $341
BNP (64 - 95), rat
1 mg AS-22931 $385
BNP - 32, human
0.5 mg AS-24015 $242
BNP - 32, human
1 mg AS-24016 $385
BNP - 45 (51 - 95), rat, 5K Cardiac Natriuretic Peptide
0.5 mg AS-61153 $303
BNP - 45, mouse
0.5 mg AS-61152 $303
C - Type Natriuretic Peptide (32 - 53), human, porcine
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6 - 22)
1 mg AS-24244 $220
Calcitonin Gene Related Peptide, CGRP, human
0.5 mg AS-20681 $154
Calcitonin Gene Related Peptide, CGRP, human
1 mg AS-20682 $259
Calcitonin, human
1 mg AS-20673 $137
Calcitonin, human
5 mg AS-20674 $577
Calcitonin, rat
5 mg AS-24205 $577
Calcitonin, salmon
1 mg AS-20677 $121
Calcitonin, salmon
5 mg AS-20678 $484
CART (55 - 102), human
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
0.1 mg AS-24154 $457
CART (55 - 102), rat
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
0.1 mg AS-24156 $457
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
0.1 mg AS-28244 $171
Chlorotoxin (Cltx) 
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
0.1 mg AS-60770 $115
Cyclo ( - GRGDSP)
GRGDSP, N to C cyclized
1 mg AS-61110 $61
Cyclo ( - RADfE), RGD negative control
Cyclo( - RADfE - )
1 mg AS-62352 $110
Cyclo ( - RADfK - ), RGD negative control
Cyclo( - RADfK - )
1 mg AS-62351 $110
Cyclo ( - RGDyK)
Cyclo( - RGDyK)
1 mg AS-61183-1 $66
Cyclo ( - RGDyK)
Cyclo( - RGDyK)
5 mg AS-61183-5 $193
Cyclo (RGDfC), avb3 Integrin Binding Cyclic RGD Peptide
Cyclo( - RGDfC)
1 mg AS-63785-1 $71
Cyclo [ - RGDyK(HiLyte™ Fluor 750)]
Cyclo[ - RGDy - K(HiLyte™ Fluor 750)]
0.1 mg AS-62333-01 $303
Cyclo [ - RGDyK(HiLyte™ Fluor 750)]
Cyclo[ - RGDy - K(HiLyte™ Fluor 750)]
1 mg AS-62333-1 $1452
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
0.1 mg AS-61641 $237
Endothelin 1, human, FAM - labeled
FAM - CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-27116 $605
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.25 mg AS-22859 $181
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-22860 $291
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-22861 $462
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-24323 $193
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-24324 $341
FITC - beta - Ala - NYAD - 1 (NYAD - 2)
FITC - (beta - A) - ITFXDLLXYYGP - NH2 (with special cyclization to get double bond, X= (S) - alpha - (2’ - pentenyl)alanine)
0.25 mg AS-63733-025 $423
hBD - 1, β - Defensin - 1, human
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)
0.1 mg AS-60740 $303
hBD - 3, β - Defensin - 3, human
0.1 mg AS-60741 $303
hBD - 4, β - Defensin - 4, human
ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK (Disulfide bridge: 6 - 33; 13 - 27; 17 - 34)
0.1 mg AS-60742 $303
HNP - 1, Defensin Human Neutrophil Peptide - 1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
0.1 mg AS-60743 $198
HNP - 2, Defensin Human Neutrophil Peptide - 2
CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1 - 29, 3 - 18, 8 - 28)
0.1 mg AS-60744 $215
Human Lactotransferrin (37 - 61), Lactoferricin H
TKCFQWQRNMRKVR - G - PPVSCIKRDS (Disulfide between Cys3 and Cys20)
1 mg AS-64074 $231
Iberiotoxin (IbTX)
Pyr - FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: C7 - C28,C13 - C33,C17 - C35)
0.1 mg AS-60763 $159
Imperatoxin A (IpTxa)
0.1 mg AS-60762 $237
Lactoferricin B, Lactoferrin (17 - 41)
1 mg AS-62651 $198
LEAP - 1, Hepcidin, human
DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7 - 23, 10 - 13, 11 - 19, 14 - 22)
0.1 mg AS-61432 $215
LyP - 1, Peptide 1
CGNKRTRGC (S - S Bonded)
1 mg AS-62169 $121
Melanin Concentrating Hormone, human, mouse, rat
DFDMLRCMLGRVYRPCWQV (Disulfide bridge: 7 - 16)
1 mg AS-22908 $215
NGR Peptide 1
CNGRCGGklaklakklaklak - NH2 (Disulfide bridge: 1 - 5)
1 mg AS-60189-1 $237
NGR Peptide 2
CNGRCGGLVTT (Disulfide bridge: 1 - 5)
1 mg AS-60190-1 $115
NGR Peptide 3
CNGRC - NH2 (Disulfide bridge: 1 - 5)
1 mg AS-60191-1 $121
NYAD - 1
ITFXDLLXYYGP - NH2 (with special cyclization to get double bond, X= (S) - alpha - (2’ - pentenyl)alanine)
1 mg AS-63734-1 $423
Orexin A, bovine, human, mouse, rat
Pyr - PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL - NH2 (Disulfide bridge: 6 - 12 and 7 - 14)
0.5 mg AS-24469 $423
Orexin A, bovine, human, mouse, rat
Pyr - PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL - NH2 (Disulfide bridge: 6 - 12 and 7 - 14)
1 mg AS-24470 $480
CYIQNCPLG - NH2 (Disulfide bridge: 1 - 6)
5 mg AS-24275 $71
CYIQNCPLG - NH2 (Disulfide bridge: 1 - 6)
25 mg AS-24276 $291
RGD - 4C
ACDCRGDCFCG (Disulfide bridge: 2 - 10 and 4 - 8)
5 mg AS-29898 $1743
RGD - targeted Proapoptotic Peptide
ACDCRGDCFC - GG - klaklakklaklak - NH2 (S - S bonded C1 - C4 & C2 - C3)
1 mg AS-62207 $363
Sarafotoxin 6c
CTCNDMTDEECLNFCHQDVIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-24325 $193
Sarafotoxin 6c
CTCNDMTDEECLNFCHQDVIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-24326 $341
Somatostatin 14
AGCKNFFWKTFTSC (Disulfide bridge: 3 - 14)
1 mg AS-24277 $55
Somatostatin 14
AGCKNFFWKTFTSC (Disulfide bridge: 3 - 14)
5 mg AS-24278 $220
Somatostatin 28
0.5 mg AS-22901 $110
Somatostatin 28
1 mg AS-22902 $154
Thrombospondin - derived Peptide; Cyclic CSVTCG
CSVTCG (S - S Bonded)
1 mg AS-65371 $95
Uroguanylin (Rat)  NEW
TDECELCINVACTGC (Disulfide bonds between Cys4 - Cys12 and Cys7 - Cys15)
1 mg AS-61645 $242
Urotensin II, human
ETPDCFWKYCV • HCl (Disulfide bridge: 5 - 10)
5 mg AS-27052 $583
WP9QY, TNF - alpha Antagonist
YCWSQYLCY (Disulfide bridge: 2 - 8)
1 mg AS-62621 $132
  < Back