Peptides  >  Glucagon-Like Peptides
Processed from a 160-amino acid proglucagon precursor, Glucagon is produced in the A-cells of the Islets of Langerhans, in the L cells of the intestinal mucosa and in specialized neurons of the central nervous system (mainly in the hypothalamus and in the medulla oblongata). It functions as a counter-regulatory hormone that opposes the actions of insulin and maintains the levels of blood glucose, particularly in patients with hypoglycemia. Glucagon regulates glucose homeostasis through enhanced synthesis and mobilization of glucose in the liver. Besides possessing insulinotropic properties and direct action on satiety center in the brain, GLP-1 may be the main hormone regulating the amount of ingested food and water.

Ref: Yamamoto, H. et al. J. Neurosci. 23, 2939 (2003); Creutzfeldt, W. et al. Exp. Clin. Endocrinol. Diabetes. 109, S288 (2001); Jin, SL. et al. J. Comp. Neurol. 271, 9 (1988); Turton, MD. et al. Nature 379, 69 (1996); Dalle, S. et al. J. Biol. Chem. 274, 10869 (1999); Tomasik, PJ. et al. Horm. Metab. Res. 34, 77 (2002); Iwasaki, Y. et al. J. Gastroenterol. 39, 831 (2004); Tang-Christensen, M. et al. Diabetes. 47, 530 (1998); Leonova, J. et al. Am. J. Physiol. Cell Physiol. 281, C1495 (2001); Rönnbäck, L. and E. Hansson, J. Neuroinflam. 1, 22 (2004); Rothstein, JD. et al. Neuron. 16, 675 (1996); Sonnewald, U. et al. Pharmacol. 301, 1 (2002).
 Product Size Catalog # US$  
[FAM - Trp31] - GLP - 1 (7 - 36), Fluorescent label at Trp31
HAEGTFTSDVSSYLEGQAAKEFIA (Trp - S - FAM) - LVKGR - NH2
HAEGTFTSDVSSYLEGQAAKEFIA (Trp - S - FAM) - LVKGR - NH2
0.5 mg 64488 $357
Biotin - Glucagon (1 - 29), bovine, human, porcine
Biotin - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Biotin - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg 60274-05 $143
Biotin - Glucagon (1 - 29), bovine, human, porcine
Biotin - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Biotin - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg 60274-1 $242
Biotin - Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
Biotin - HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
Biotin - HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg 23586 $198
Biotin - Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
Biotin - HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
Biotin - HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg 23587 $335
GLP - 1(9 - 36), amide, human
EGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
EGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg 65070 $203
GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
1 mg 62068 $297
Glucagon (1 - 18)
HSQGTFTSDYSKYLDSRR
HSQGTFTSDYSKYLDSRR
1 mg 64344-1 $110
Glucagon (1 - 29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg 22456 $71
Glucagon (1 - 29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg 22457 $127
Glucagon (1 - 29), bovine, human, porcine, FAM - labeled
FAM - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
FAM - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg 60273-05 $143
Glucagon (1 - 29), bovine, human, porcine, FAM - labeled
FAM - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
FAM - HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg 60273-1 $242
Glucagon (1 - 37), Oxyntomodulin, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
1 mg 22455 $665
Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg 22462 $127
Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg 22463 $231
Glucagon - Like Peptide 1, GLP - 1 (7 - 36) - Lys(Biotin), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin) - NH2
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin) - NH2
0.5 mg 23642 $275
Glucagon - Like Peptide 1, GLP - 1 (7 - 36) - Lys(Biotin), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin) - NH2
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin) - NH2
1 mg 23643 $457
Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
0.5 mg 20761 $154
Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
1 mg 20762 $275
Glucagon - Like Peptide 1, GLP - 1 amide, human
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg 22460 $181
Glucagon - Like Peptide 1, GLP - 1 amide, human
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg 22461 $335
Glucagon - Like Peptide 1, GLP - 1 amide, human, FAM - labeled
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
0.5 mg 23606 $291
Glucagon - Like Peptide 1, GLP - 1 amide, human, FAM - labeled
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
1 mg 23607 $484
Glucagon - like Peptide - 2, GLP - 2 (146 - 178), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
1 mg 62070 $281
  < Back