Peptides  >  Natriuretic Peptides
Natriuretic peptides are a family of naturally occurring proteins that play a major role in down-regulating the activity of the renin-angiotensin-aldosterone system; regulating circulatory homeostasis; modulating cardiovascular system, causing natriuresis and vasodilatation. There are at least three major natriuretic peptides that have been discovered: atrial natriuretic peptide (ANP)- secreted largely by the atria; brain natriuretic peptide (BNP) - produced by the ventricles and C-type natriuretic peptide (CNP)- located in peripheral blood vessels.

Ref: De Bold , A. et al. Life Sci. 28, 89 (1981); Maeda, K. et al. Am. Heart J. 135, 825 (1998); Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Struthers, A. BMJ 308, 1615 (1994); Levin, E. et al. N. Engl. J. Med. 339, 321 (1998); Cheung, B. et al. JAMA 280, 1983 (1998); Kalra, P. et al. Eur. Heart J. 22, 997 (2001); Ee Lemos, JA. et al. Lancet 362, 316 (2005).
 Product Size Catalog # US$  
Atrial Natriuretic Peptide (1 - 28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
0.5 mg 20647 $121
Atrial Natriuretic Peptide (1 - 28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
1 mg 20648 $145
Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
0.5 mg 23972 $181
Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
1 mg 23973 $303
Atrial Natriuretic Peptide (1 - 28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
0.5 mg 20651 $121
Atrial Natriuretic Peptide (1 - 28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)
1 mg 20652 $150
Atrial Natriuretic Peptide (4 - 18), rat
RSSCFGGRIDRIGAC - NH2 (Disulfide bridge 4 - 15)
RSSCFGGRIDRIGAC - NH2 (Disulfide bridge 4 - 15)
1 mg 62839 $143
BNP (64 - 95), rat
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10 - 26)
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10 - 26)
1 mg 22931 $385
BNP - 32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)
0.5 mg 24015 $242
BNP - 32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)
1 mg 24016 $385
BNP - 45 (51 - 95), rat, 5K Cardiac Natriuretic Peptide
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
(Disulfide bridge:23 - 39)
0.5 mg 61153 $303
BNP - 45, mouse
SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23 - 39)
SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL
(Disulfide bridge:23 - 39)
0.5 mg 61152 $303
C - Type Natriuretic Peptide (32 - 53), human, porcine
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6 - 22)
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6 - 22)
1 mg 24244 $220
Thr - Ala - Pro - Arg - Atrial Natriuretic Peptide, Urodilatin, human
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11 - 27)
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11 - 27)
1 mg 20650 $264
  < Back