Peptides  >  Toxins
 Product Size Catalog # US$  
ω - Conotoxin GVIA
0.5 mg AS-22926 $242
ω - Conotoxin GVIA
1 mg AS-22927 $396
ω - Conotoxin MVIIA
CKGKGAKCSRLMYDCCTGSCRSGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20, and 15 - 25)
0.5 mg AS-20579 $363
ω - Conotoxin MVIIA
CKGKGAKCSRLMYDCCTGSCRSGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20, and 15 - 25)
1 mg AS-27057 $665
ω - Conotoxin MVIIC
CKGKGAPCRKTMYDCCSGSCGRRGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20,and 15 - 26)
0.1 mg AS-20580 $143
ω - Conotoxin MVIIC
CKGKGAPCRKTMYDCCSGSCGRRGKC - NH2 (Disulfide bridge: 1 - 16, 8 - 20,and 15 - 26)
0.5 mg AS-27058 $583
[Glu32] - Charybdotoxin
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKECRCYS (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
0.1 mg AS-61200-01 $143
CNCKAPETALCARRCQQH - NH2 (Disulfide bridge: 1 - 11; 3 - 15)
0.5 mg AS-60772 $115
Botulinum Neurotoxin (BoNT) B Substrate Modification, amide, FITC - labeled
1 mg AS-60246-1 $479
Caloxin 1b1
1 mg AS-64236 $93
Caloxin 2A1
1 mg AS-62604 $110
Caloxin 3A1
1 mg AS-62606 $143
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7 - 28, 13 - 33 and 17 - 35)
0.1 mg AS-28244 $171
Chlorotoxin (Cltx)
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
0.1 mg AS-60770 $115
Conantokin G
GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN - NH2
0.5 mg AS-24281 $242
Conantokin G
GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN - NH2
1 mg AS-24282 $385
Delta - Toxin (1 - 26), Staphylococcus aureus
1 mg AS-62496 $203
Iberiotoxin (IbTX)
Pyr - FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: C7 - C28,C13 - C33,C17 - C35)
0.1 mg AS-60763 $159
Imperatoxin A (IpTxa)
0.1 mg AS-60762 $237
Sarafotoxin 6c
CTCNDMTDEECLNFCHQDVIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-24325 $193
Sarafotoxin 6c
CTCNDMTDEECLNFCHQDVIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-24326 $341
Tetanus Toxin (830844)
1 mg AS-62410 $99
  < Back