Peptides  >  Protein Phosphorylation Related Peptides
 Product Size Catalog # US$  
ε - V1 - 2, ε - PKC Inhibitor
EAVSLKPT
1 mg AS-62186 $71
[GalNAc - Ser] - Erythropoietin (Epo) (117 - 131)
EAISPPDAA - *S - AAPLR (*S=GalNAc - Ser)
0.5 mg AS-62744 $303
[pS345] - Chk1
QGISF - pS - QPTC
1 mg AS-62819 $176
[pSer5] - Kemptide, 5 - TMR labeled
5 - TMR - LRRA - pS - LG
1 mg AS-60467-1 $445
[pSer5] - Kemptide, HiLyte™ Fluor 488 labeled
HiLyte™ Fluor 488 - LRRA - pS - LG
1 mg AS-61234 $281
[Ser25] - PKC (19 - 31), biotinylated
K(Biotin) - RFARKGSLRQKNV
1 mg AS-23018 $99
5 - FAM - GPHRSTPESRAAV 1 mg AS-60519-1 $247
5 - FAM - GRPRTSSFAEG 1 mg AS-60435-1 $247
5 - FAM - KRREILSRRPSYR 1 mg AS-60436-1 $247
5 - FAM - KVEKIGEGTYGVVYK 1 mg AS-60287-1 $247
5 - FAM - PLSRTLSVSS - NH2 1 mg AS-60515-1 $247
5 - TMR - GPHRSTPESRAAV 1 mg AS-60520-1 $308
5 - TMR - RRADDSDDDDD 1 mg AS-60539-1 $308
5 - TMR - RRKDLHDDEEDEAMSITA 1 mg AS-60549-1 $308
5 - TMR - YIYGSFK 1 mg AS-60429-1 $308
Abl Cytosolic Substrate
EAIYAAPFAKKK
1 mg AS-60613 $115
Abltide
KKGEAIYAAPFA - NH2
1 mg AS-61749 $99
Abltide, TAMRA - labeled
5 - TAMRA - KKGEAIYAAPFA - NH2
1 mg AS-61750 $264
Akt Specific Substrate Peptide, Akt/PKB
RPRAATF
1 mg AS-60612 $121
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTY - pS - FGHHA], Phosphorylated
ARKRERTY - pS - FGHHA
1 mg AS-29946-1 $225
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA]
ARKRERTYSFGHHA
1 mg AS-29944-1 $110
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA]
ARKRERTYSFGHHA
5 mg AS-29944-5 $445
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA], Biotinylated
Biotin - ARKRERTYSFGHHA
1 mg AS-29945-1 $143
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA], Biotinylated
Biotin - ARKRERTYSFGHHA
5 mg AS-29945-5 $572
AMARA peptide
AMARAASAAALARRR
1 mg AS-62596 $93
AMPKtide
5 - FAM - LKKLTRRASFSAQ
1 mg AS-61747 $99
Aquaporin - 2 (254 - 267), pSER256, human
RQ - pS - VELHSPQSLPR
1 mg AS-61325 $127
Aquaporin - 2 (254 - 267), pSER261, human
RQSVELH - pS - PQSLPR
1 mg AS-61328 $127
Autocamtide - 2 [KKALRRQETVDAL]
KKALRRQETVDAL
5 mg AS-60249-5 $330
Autocamtide - 2 [KKALRRQETVDAL], Phosphorylated
KKALRRQE - pT - VDAL
1 mg AS-29929-1 $181
Autocamtide - 2 [KKALRRQETVDAL], Phosphorylated
KKALRRQE - pT - VDAL
5 mg AS-29929-5 $743
Biotin - KRREILSRRPSYR 1 mg AS-23986 $181
Bovine ß - Casein, monophosphopeptide
FQ - pS - EEQQQTEDELQDK
1 mg AS-61146 $159
Bovine ß - Casein, tetraphosphopeptide
RELEELNVPGEIVE - pS - L - pS - pS - pS - EESITR
0.5 mg AS-61147 $231
BTK derived peptide
KKVVALYDYMPMN - NH2
1 mg AS-61728 $99
BTK derived peptide, FAM - labeled
5 - FAM - KKVVALYDYMPMN - NH2
1 mg AS-61729 $242
Calcineurin (PP2B) Substrate [DLDVPIPGRFDRRV - pS - VAAE], Biotinylated
Biotin - DLDVPIPGRFDRRV - pS - VAAE
5 mg AS-29962-5 $1215
Casein Kinase 2 (CK2) Substrate α - subunit
RRRDDDSDDD
1 mg AS-60615 $121
Casein Kinase I Substrate [RRKDLHDDEEDEAMSITA], Biotinylated
Biotin - RRKDLHDDEEDEAMSITA
5 mg AS-60550-5 $731
Casein Kinase II Substrate [RRADDSDDDDD]
RRADDSDDDDD
5 mg AS-60537-5 $479
Cathepsin D and E FRET Substrate
Mca - GKPILFFRLK(Dnp) - r - NH2
1 mg AS-61793 $143
Cathepsin K substrate
Abz - HPGGPQ - EDDnp
0.1 mg AS-62368 $115
CDK5 Substrate [PK - pT - PKKAKKL], Phosphorylated
PK - pT - PKKAKKL
1 mg AS-29982-1 $193
CDK5 Substrate [PKTPKKAKKL]
PKTPKKAKKL
5 mg AS-60026-5 $407
CDK5 Substrate [PKTPKKAKKL], 5 - FAM labeled
5 - FAM - PKTPKKAKKL
1 mg AS-29980-1 $225
CDK5 Substrate [PKTPKKAKKL], 5 - FAM labeled
5 - FAM - PKTPKKAKKL
5 mg AS-29980-5 $913
CDK5 Substrate [PKTPKKAKKL], 5 - TMR labeled
5 - TMR - PKTPKKAKKL
1 mg AS-29981-1 $269
CDK5 Substrate [PKTPKKAKKL], Biotinylated
Biotin - PKTPKKAKKL
5 mg AS-60027-5 $457
CDK7/9 tide
YSPTSPSYSPTSPSYSPTSPSKKKK
1 mg AS-63367 $198
CDK7tide
YSPTSPSYSPTSPSYSPTSPS
1 mg AS-61758 $171
CDK7tide, TAMRA labeled
5 - TAMRA - YSPTSPSYSPTSPSYSPTSPS
1 mg AS-61759 $297
CK1tide
HAAIGDDDDAYSITS - NH2
1 mg AS-61767 $93
CREBtide [KRREILSRRPSYR]
KRREILSRRPSYR
5 mg AS-60510-5 $479
CREBtide [KRREILSRRPSYR], 5 - FAM labeled
5 - FAM - KRREILSRRPSYR
5 mg AS-60436-5 $985
CREBtide [KRREILSRRPSYR], Phosphorylated, C - term K
KRREILSRRPS - pY - RK
1 mg AS-27018 $193
CREBtide [KRREILSRRPSYR], Phosphorylated, C - term KC
KRREILSRRP - pS - YRKC
1 mg AS-29865 $203
Crosstide [GRPRTSSFAEG]
GRPRTSSFAEG
5 mg AS-60209-5 $281
Crosstide [GRPRTSSFAEG], 5 - FAM labeled
5 - FAM - GRPRTSSFAEG
5 mg AS-60435-5 $985
delta PKC (8 - 17); PKC d Inhibitor
SFNSYELGSL
1 mg AS-65111 $66
DNA - PK Substrate
EPPLSQEAFADLWKK
5 mg AS-60210-5 $363
EGF Receptor Substrate 2 [DADE - pY - LIPQQG]
DADE - pY - LIPQQG
5 mg AS-24434 $963
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], 5 - FAM labeled
5 - FAM - DADE - pY - LIPQQG
1 mg AS-29971-1 $303
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], 5 - FAM labeled
5 - FAM - DADE - pY - LIPQQG
5 mg AS-29971-5 $1215
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], Biotinylated
Biotin - DADE - pY - LIPQQG
1 mg AS-29972-1 $203
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ]
ADEYLIPQQ
1 mg AS-29942-1 $99
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ]
ADEYLIPQQ
5 mg AS-29942-5 $379
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ], 5 - FAM labeled
5 - FAM - ADEYLIPQQ
1 mg AS-29941-1 $237
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ], Biotinylated
Biotin - ADEYLIPQQ
1 mg AS-29936-1 $193
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ], Biotinylated
Biotin - ADEYLIPQQ
5 mg AS-29936-5 $759
epsilon - V1 - 2, epsilon - PKC Inhibitor, Cys - conjugated
EAVSLKPTC
1 mg AS-62187 $83
ERK 1/2 /MAP Kinase Substrate, FAM labeled
5 - FAM - IPTSPITTTYFFFKKK
1 mg AS-62342 $242
ERKtide
ATGPLSPGPFGRR
1 mg AS-60211-1 $77
ERKtide
ATGPLSPGPFGRR
5 mg AS-60211-5 $313
Erktide
IPTTPITTTYFFFK
1 mg AS-61777 $93
Erktide, FAM - labeled
IPTTPITTTYFFF - K (5 - FAM) - OH
1 mg AS-61778 $237
ERMRPRKRQGSVRRRV 1 mg AS-27183 $132
FceRI g - Chain
pY - TGLSTRNQET - pY - ETL - NH2
1 mg AS-61774 $203
Forkhead derived peptide, Woodtide
KKISGRLSPIMTEQ - NH2
1 mg AS-61743 $105
Glycogen Synthase 1 - 8 [PLSRTLSVAAKK - NH2] 1 mg AS-27177 $83
Glycogen Synthase derived peptide - TAMRA labeled
5 - TAMRA - KKLNRTLSVA
1 mg AS-61787 $247
GPHRSTPESRAAV 1 mg AS-60518-1 $121
GPHRSTPESRAAV, 5 - TMR labeled
5 - TMR - GPHRSTPESRAAV
5 mg AS-60520-5 $1237
GSK - 3 Substrate, Biotinylated
Biotin - RRAAEELDSRAGSPQL
5 mg AS-23965 $555
GSK3 Substrate, a, b subunit
RAAVPPSPSLSRHSSPHQSEDEEE
1 mg AS-60617 $325
HATPPKKKRK
HATPPKKKRK
5 mg AS-60522-5 $479
Histone deacetylase, HDAC substrate
Ac - RGK(Ac) - AMC
1 mg AS-61855 $143
Histone H1 - derived Peptide
GGGPATPKKAKKL
1 mg AS-61761 $83
Histone H1 - derived Peptide, FAM - labeled
5 - FAM - GGGPATPKKAKKL
1 mg AS-61762 $231
Histone H1 - derived Peptide, phosphorylated
GGGPA - pT - PKKAKKL
1 mg AS-61741 $181
Histone H1 - derived Peptide, TAMRA labeled
5 - TAMRA - GGGPATPKKAKKL
1 mg AS-61763 $253
Insulin B (9 - 23)
SHLVEALYLVCGERG
1 mg AS-61532 $115
Insulin Receptor (1142 - 1153)
TRDIYETDYYRK
1 mg AS-24537 $115
Insulin Receptor (1142 - 1153)
TRDIYETDYYRK
5 mg AS-24538 $457
Insulin Receptor (1142 - 1153), pTyr(1146, 1150, 1151)
TRDI - pY - ETD - pY - pY - RK
1 mg AS-20272 $303
Insulin Receptor (1142 - 1153), pTyr1146
TRDI - pY - ETDYYRK
1 mg AS-20292 $247
Insulin Receptor (1142 - 1153), pTyr1150
TRDIYETD - pY - YRK
1 mg AS-20274 $247
IP3R - derived Peptide
GRRESLTSFG - NH2
1 mg AS-61730 $83
IRS1 - derived peptide
KKSRGDYMTMQIG - NH2
1 mg AS-61764 $83
Jak3tide
GGEEEEYFELVKKKK
1 mg AS-62537 $93
Kemptide [LKRA - pY - LG] - [Lys2, pTyr5]
LKRA - pY - LG - NH2
1 mg AS-20290 $193
Kemptide [LRRASLG]
LRRASLG
5 mg AS-22594 $77
Kemptide [LRRASLG]
LRRASLG
25 mg AS-22595 $303
Kemptide [LRRASLG], 5 - FAM labeled
5 - FAM - LRRASLG
1 mg AS-29933-1 $215
Kemptide [LRRASLG], 5 - FAM labeled
5 - FAM - LRRASLG
5 mg AS-29933-5 $858
Kemptide [LRRASLG], 5 - TAMRA labeled
5 - TMR - LRRASLG
1 mg AS-29934-1 $281
Kemptide [LRRASLG], Biotinylated
Biotin - LRRASLG
1 mg AS-60527 $159
Kemptide [LRRASLG], Biotinylated
Biotin - LRRASLG
5 mg AS-24533 $176
Kemptide [LRRASLG], Biotinylated
Biotin - LRRASLG
25 mg AS-24534 $709
Kemptide [LRRASLG], HiLyte™ Fluor 488 labeled
HiLyte™ Fluor 488 - LRRASLG
1 mg AS-61233 $237
Kemptide [LRRWSLG] - [Trp4]
LRRWSLG
25 mg AS-22599 $303
Keratin K18 - C
RPVSSAApSVYAGAC
1 mg AS-60214-1 $132
Keratin K18 - C
RPVSSAApSVYAGAC
5 mg AS-60214-5 $533
Kinase Substrates Library, Group I, biotinylated, 180 distinct peptide mixtures 1 Set AS-62017-1 $5693
Kinase Substrates Library, Group II, biotinylated, 18 distinct peptide mixtures 1 Set AS-62335 $1711
KVEKIGEGTYGVVYK 1 mg AS-60551-1 $121
MARCKS Peptide (151 - 175)
KKKKKRFSFKKSFKLSGFSFKKNKK
1 mg AS-22576 $193
MARCKS Peptide (151 - 175), Phosphorylated
KKKKKRF - pS - FKK - pS - FKLSGF - pS - FKKNKK
0.5 mg AS-24508 $352
MARCKS Protein (154 - 165) [KKRFSFKKSFKL], 5 - TMR labeled
5 - TMR - KKRFSFKKSFKL
1 mg AS-29916-1 $291
MBP MAPK Substrate
APRTPGGRR
1 mg AS-27167 $49
MBP MAPK Substrate
APRTPGGRR
5 mg AS-27168 $193
MBP, MAPK Substrate, 5 - TMR labeled
5 - TMR - APRTPGGRR
1 mg AS-60272-1 $308
MBP, MAPK Substrate, Biotinylated 1 mg AS-60747 $77
MBP, MAPK Substrate, Biotinylated
Biotin - APRTPGGRR
5 mg AS-27170 $303
MBP, MAPK Substrate, Biotinylated, Phosphorylated
Biotin - APR - pT - PGGRR
1 mg AS-29877 $247
MCA - EDAEY(PO3)AAK(DNP)R - NH2 1 mg AS-60512-1 $297
MLC - derived peptide
KKRPQRRYSNVF
1 mg AS-61781 $83
Myristolated PKC Zeta, Pseudosubstrate (ZIP)
Myr - SIYRRGARRWRKL
1 mg AS-63361 $121
Myristolated PKC Zeta, Pseudosubstrate ZIP, Scrambled
Myristoyl - RLYRKRIWRSAGR
1 mg AS-63695 $121
Neurogranin 28 - 43 [AAKIQASFRGHMARKK], 5 - TMR labeled
5 - TMR - AAKIQASFRGHMARKK
1 mg AS-29992-1 $319
Neurogranin 28 - 43 [AAKIQASFRGHMARKK], Biotinylated - LC
Biotin - LC - AAKIQASFRGHMARKK
5 mg AS-27176 $605
PAKtide
RRRLSFAEPG
1 mg AS-61874 $71
PDKtide
KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
1 mg AS-64225 $374
PDKtide, biotin labeled
Biotin - Ahx - KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
1 mg AS-64224 $385
phosphorylated, Histone H1 - derived peptide, FAM - labeled
5 - FAM - GGGPA - pT - PKKAKKL - OH
1 mg AS-61742 $325
PKA Substrate, Catalytic Subunit
GRTGRRNSI
1 mg AS-60611 $132
PKA, PKC, MAPKAP - K1 Substrate [RRRLSSLRA - NH2]
RRRLSSLRA - NH2
1 mg AS-29983-1 $115
PKA, PKC, MAPKAP - K1 Substrate [RRRLSSLRA - NH2]
RRRLSSLRA - NH2
5 mg AS-29983-5 $457
PKC Substrate [RRGR - pT - GRGRRGIFR], Phosphorylated
RRGR - pT - GRGRRGIFR
5 mg AS-60546-5 $985
PKG Substrate [RKRSRAE], Glasstide 1 mg AS-60298-1 $88
PKG Substrate [RKRSRAE], Glasstide
RKRSRAE
5 mg AS-60298-5 $352
PKTPKKAKKL 1 mg AS-60026-1 $99
pp60(v - SRC) Autophosphorylation Site
RRLIEDNEYTARG
1 mg AS-22553 $55
pp60(v - SRC) Autophosphorylation Site, Phosphorylated
RRLIEDNE - pY - TARG
1 mg AS-22555 $127
pp60C - SRC Carboxy - Terminal Phosphoregulatory Peptide
TSTEPQYQPGENL
1 mg AS-22913 $66
pp60C - SRC Carboxy - Terminal Phosphoregulatory Peptide, Phosphorylated
TSTEPQ - pY - QPGENL
1 mg AS-22914 $99
pp60C - SRC Carboxy - Terminal Phosphoregulatory Peptide, Phosphorylated
TSTEPQ - pY - QPGENL
5 mg AS-24543 $407
Protein Kinase G Substrate [QKRPRRKDTP], Biotinylated
Biotin - QKRPRRKDTP
1 mg AS-29996-1 $209
Protein Kinase G Substrate [QKRPRRKDTP], Biotinylated
Biotin - QKRPRRKDTP
5 mg AS-29996-5 $836
Protein Kinase G Substrate [QKRPRRKDTP], Phosphorylated
QKRPRRKD - pT - P
1 mg AS-29997-1 $193
Protein Kinase G Substrate [QKRPRRKDTP], Phosphorylated
QKRPRRKD - pT - P
5 mg AS-29997-5 $759
Protein Tyrosine Phosphatase 1B Substrate [ELEF - pY - MDYE - NH2]
ELEF - pY - MDYE - NH2
1 mg AS-29950-1 $198
Protein Tyrosine Phosphatase 1B Substrate [ELEF - pY - MDYE - NH2]
ELEF - pY - MDYE - NH2
5 mg AS-29950-5 $787
Psi - RACK, epsilon - C2/V1 (82 - 92), epsilon PKC (82 - 92), C2 Domain
HDAPIGYD
1 mg AS-62188 $71
RRADDSDDDDD 1 mg AS-60537-1 $121
RRLIEDAEYAARG 1 mg AS-22581 $71
RS domain derived peptide
GRSRSRSRSR
1 mg AS-61722 $71
RS - domain derived peptide, FAM - labeled
5 - FAM - GRSRSRSRSR - OH
1 mg AS-61723 $220
S3 Fragment, ADF/cofilin
MASGVMVSDDVVKVFN
1 mg AS-62637 $99
S6 Kinase Substrate (229 - 239)
AKRRRLSSLRA
1 mg AS-27191 $83
S6 Kinase Substrate (229 - 239)
AKRRRLSSLRA*
5 mg AS-27192 $319
S6 Kinase Substrate (229 - 239), Amide, Biotinalyted
Biotin - AKRRRLSSLRA - NH2
1 mg AS-27193 $127
S6 Kinase Substrate (229 - 239), Amide, Biotinalyted
Biotin - AKRRRLSSLRA - NH2
5 mg AS-27194 $506
S6 Kinase Substrate (229 - 239), C - term STSKSESSQK
AKRRRLSSLRASTSKSESSQK
1 mg AS-60589-1 $291
SAMS Peptide
HMRSAMSGLHLVKRR - NH2
1 mg AS-60167-1 $115
SAMS Peptide
HMRSAMSGLHLVKRR - NH2
5 mg AS-60167-5 $462
SH2 Domain Ligand (2)
EPQ - pY - EEIPIYL*
1 mg AS-25062 $215
Src Optimal Peptide Substrate
AEEEIYGEFEAKKKK
1 mg AS-60222-1 $93
Src Optimal Peptide Substrate
AEEEIYGEFEAKKKK
5 mg AS-60222-5 $363
Syntide - 2 [PLARTLSVAGLPGKK]
PLARTLSVAGLPGKK
5 mg AS-22552 $203
Threonine Phosphopeptide,PKC Substrate 4, phosphorylated
KR - pT - IRR
1 mg AS-20291 $181
Threonine Phosphopeptide,PKC Substrate 4, phosphorylated
KR - pT - IRR
5 mg AS-24499 $726
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK]
KVEKIGEGTYGVVYK
5 mg AS-60551-5 $479
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5 - TMR labeled
5 - TMR - KVEKIGEGTYGVVYK
1 mg AS-29935-1 $352
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5 - TMR labeled
5 - TMR - KVEKIGEGTYGVVYK
5 mg AS-29935-5 $1419
Tyrosine Kinase Peptide 3 [RRLIEDAE - pY - AARG], Phosphorylated
RRLIEDAE - pY - AARG
1 mg AS-24546 $127
Tyrosine Kinase Peptide 3 [RRLIEDAEYAARG]
RRLIEDAEYAARG
5 mg AS-22582 $281
UOM9, PKC Substrate, phosphorylated
KRP - pS - QRHGSKY - NH2
1 mg AS-20294 $215
YIYGSFK 1 mg AS-27197 $66
ZIPtide
KKLNRTLSFAEPG
1 mg AS-63366 $77
  < Back