Peptides  >  Signal Transduction Peptides
 Product Size Catalog # US$  
α - Mating Factor Pheromone, yeast
WHWLQLKPGQPMY
5 mg 60221-5 $250
Ac - PGP
Ac - PGP
1 mg 62009 $61
Beta - Amyloid (1 - 12), Human
DAEFRHDSGYEV
1 mg 62967 $83
Beta - Amyloid (1 - 22), Human
DAEFRHDSGYEVHHQKLVFFAE
1 mg 62966 $181
Beta - Amyloid (1 - 40) - Lys(Biotin) - NH2, mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - K(Biotin) - NH2
0.1 mg 63356 $165
Beta - Amyloid (4 - 24), Human
FRHDSGYEVHHQKLVFFAEDV
1 mg 62961 $176
Beta - Amyloid (5 - 40), Human
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 62964 $325
CaMKI, Calmodulin - Dependent Protein Kinase I (299 - 320) Binding Domain
AKSKWKQAFNATAVVRHMRKLQ
1 mg 63753 $176
Cyclo ( - RADfE), RGD negative control
Cyclo( - RADfE - )
1 mg 62352 $110
Dyrktide
RRRFRPASPLRGPPK
1 mg 62698 $93
EMP17, FITC - LC labeled
FITC - LC - TYSCHFGPLTWVCKPQGG
1 mg 60180-1 $110
Erythropoietin - Mimetic Peptide 17 (EMP17)
TYSCHFGPLTWVCKPQGG
1 mg 64437 $83
Glucagon peptide 50 g 29667P $110
GS2, Glycogen Synthase Peptide - 2
YRRAAVPPSPSLSRHSSPHQ - pS - EDEEE
1 mg 63722 $297
Human IkBa (20 - 39)
LKKERLLDDRHDSGLDSMKD
1 mg 61671 $121
IRBP, Interphotoreceptor Retinoid Binding Protein Fragment
SGIPYIISYLHPGNTILHVD
1 mg 60183-1 $121
IRBP, Interphotoreceptor Retinoid Binding Protein Fragment
SGIPYIISYLHPGNTILHVD
5 mg 60183-5 $484
JAG - 1 (188 - 204), Jagged - 1 (188 - 204), Notch Ligand, DSL Peptide
CDDYYYGFGCNKFCRPR
1 mg 61298 $171
M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK - MLCK M13
KRRWKKNFIAVSAANRFKKISSSGAL
1 mg 60184-1 $203
M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK - MLCK M13
KRRWKKNFIAVSAANRFKKISSSGAL
5 mg 60184-5 $825
Pannexin - 1 (Panx1), Mimetic Blocking Peptide
WRQAAFVDSY
1 mg 61911 $71
PDE(p), Calmodulin Binding Domain
QTEKMWQRLQRLKGILRSLVKQ
1 mg 63762 $181
Protease - Activated Receptor - 1, PAR - 1 Agonist
TFLLRN
1 mg 61530 $61
RIAD, FAM labeled
LEQYANQLADQIIKEATE - K(FAM) - NH2
1 mg 62018 $253
Scrambled Jag1
SC - Jag1
1 mg 64239 $171
SmMLCKp, Smooth - Muscle Myosin Light - Chain Kinase (796 - 815), Calmodulin Binding
ARRKWQKTGHAVRAIGRLSS
1 mg 63752 $121
Steroid Receptor Co - Factor Peptide
LTERHKILHRLLQE
1 mg 60199-1 $83
Steroid Receptor Coactivator - 1 (SRC - 1), (676 - 700), biotin labeled
Biotin - CPSSHSSLTERHKILHRLLQEGSPS
1 mg 62152 $242
Steroid Receptor Coactivator - 1, SRC - 1 (686 - 700)
RHKILHRLLQEGSPS
1 mg 64661 $83
Tau - Protein (1 - 16)
MAEPRQEFEVMEDHAG
1 mg 62959 $99
Tau - Protein (323 - 335)
GSLGNIHHKPGGG
1 mg 62958 $83
TET 830 modified/T - helper epitope from tetanus toxoid
AQYIKANSKFIGITEL
1 mg 60622 $154
TIF2 (740 - 753), Transcriptional Intermediary Factor 2 (740 - 753)
KENALLRYLLDKDD
1 mg 61992 $93
W Peptide, WKYMVm - NH2
WKYMVm - NH2
1 mg 27069 $61
WRW4, Formyl Peptide Receptor - Like 1 (FPRL1) Antagonist
WRWWWW
1 mg 62638 $71
  < Back