Fluorescent Dyes  >  Fluorescent Biopolymers
Phycobiliproteins and Their Conjugates
Phycobiliproteins are a family of highly soluble and fluorescent proteins derived from cyanobacteria and eukaryotic algae. In these organisms, they are used as accessory or antenna pigments for the collection of photosynthetic light. Phycobiliproteins absorb energy in parts of the visible spectrum that are poorly utilized by chlorophyll and convey the energy to chlorophyll at the photosynthetic reaction center through fluorescence resonance energy transfer.
β-Amyloid Peptides and Related Assay Reagents
The formation of amyloid plaques and neurofibrillary tangles are thought to contribute to the degradation of the neurons (nerve cells) in the brain and the subsequent symptoms of Alzheimer’s disease. One of the distinctive features of Alzheimer’s disease is the accumulation of amyloid plaques between nerve cells (neurons) in the brain. These plaques consist primarily of the β-amyloid protein; however, other proteins, such as apoE, are also present.
In recent years there have been extensive studies to investigate the mechanism of Alzheimer’s disease and the roles of β-amyloid in the cause of Alzheimer’s disease. To accelerate your research, AnaSpec offers the most comprehensive lists of biotinylated and fluorophore-labeled β-amyloid. Peptides labeled with our HiLyte Fluor™ dyes demonstrate better performance than β-amyloid peptides that are labeled with classic dyes such as FITC, FAM, TAMRA and Texas Red®. We also offer isotope-labeled and single amino acid-mutated β-amyloid peptides that are not included in this catalog, but can be found in our general catalog or from our website www.anaspec.com.
 Product Size Catalog # US$  
B - PE (B - Phycoerythrin) 1 mg AS-82001 $61
Beta - Amyloid (1 - 11), Human
1 mg AS-22819 $71
Beta - Amyloid (1 - 15), Human
1 mg AS-61798 $93
Beta - Amyloid (1 - 15) - Lys16(HiLyte™ Fluor 488), Human 0.5 mg AS-62002-05 $237
Beta - Amyloid (1 - 16), Human
1 mg AS-24225 $83
Beta - Amyloid (1 - 16), Human
5 mg AS-24226 $341
Beta - Amyloid (1 - 17), Human
1 mg AS-61955 $110
Beta - Amyloid (1 - 17), HiLyte™ Fluor 488 - labeled, Human
0.1 mg AS-62953 $115
Beta - Amyloid (1 - 40) • HFIP, Human
1 mg AS-64128-1 $303
Beta - Amyloid (1 - 40) Binding Peptide, Biotin - labeled
1 mg AS-62427 $187
Beta - Amyloid (1 - 40), Human
0.5 mg AS-24235 $132
Beta - Amyloid (1 - 40), Human
1 mg AS-24236 $220
Beta - Amyloid (1 - 40), AMCA - LC - labeled, Human
0.1 mg AS-60487-01 $181
Beta - Amyloid (1 - 40), DEAC - labeled, Human
(7 - Diethylaminocoumarin - 3 - yl)carbonyl - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg AS-61949-01 $143
Beta - Amyloid (1 - 40), FAM - labeled, Human
0.1 mg AS-23514-01 $132
Beta - Amyloid (1 - 40), FAM - labeled, Human
0.5 mg AS-23513-05 $484
Beta - Amyloid (1 - 40), HiLyte™ Fluor 488 - labeled, Human
0.1 mg AS-60491-01 $220
Beta - Amyloid (1 - 40), HiLyte™ Fluor 555 - labeled, Human
0.1 mg AS-60492-01 $220
Beta - Amyloid (1 - 40), HiLyte™ Fluor 647 - labeled, Human 0.1 mg AS-60493 $220
Beta - Amyloid (1 - 40), Rhodamine Green - labeled, Human
0.1 mg AS-61134 $115
Beta - Amyloid (1 - 40), Sulforhodamine 101 - labeled, Human 0.1 mg AS-60489 $220
Beta - Amyloid (1 - 40), TAMRA - labeled, Human
0.1 mg AS-60488-01 $220
Beta - Amyloid (1 - 40) - Lys(Biotin) - NH2, FAM - labeled, Human
0.1 mg AS-23597-01 $237
Beta - Amyloid (1 - 40) - Lys(Biotin) - NH2, FAM - labeled, Human
0.5 mg AS-23596 $787
Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human
0.1 mg AS-61962-01 $237
Beta - Amyloid (1 - 42), Human
0.5 mg AS-24224 $150
Beta - Amyloid (1 - 42), Human
1 mg AS-20276 $280
Beta - Amyloid (1 - 42), AMCA - LC - labeled, Human
0.1 mg AS-60475-01 $215
Beta - Amyloid (1 - 42), FAM - labeled, Human
0.1 mg AS-23526-01 $165
Beta - Amyloid (1 - 42), FAM - labeled, Human
0.5 mg AS-23525-05 $605
Beta - Amyloid (1 - 42), HiLyte™ Fluor 488 - labeled, Human
0.1 mg AS-60479-01 $237
Beta - Amyloid (1 - 42), HiLyte™ Fluor 555 - labeled, Human
0.1 mg AS-60480-01 $237
Beta - Amyloid (1 - 42), Scrambled, 5 - FAM labeled, Human
0.1 mg AS-60892 $237
Beta - Amyloid (1 - 42), TAMRA - labeled, Human 0.1 mg AS-60476 $247
Beta - Amyloid (1 - 42) - Lys(Biotin), FAM - labeled, Human
0.1 mg AS-23599-01 $291
Beta - Amyloid (1 - 42) - Lys(Biotin), FAM - labeled, Human
0.5 mg AS-23598 $968
Beta - Amyloid (1 - 9), Human
1 mg AS-61970 $71
Beta - Amyloid (11 - 40), Human
0.1 mg AS-60017-01 $77
Beta - Amyloid (11 - 40), Human
1 mg AS-60017-1 $385
Beta - Amyloid (11 - 40), FAM - labeled, Human
0.1 mg AS-62950 $181
Beta - Amyloid (11 - 42), HiLyte™ Fluor 488 - labeled, Human
0.1 mg AS-63327 $181
Beta - Amyloid (16 - 20), Human, mouse/rat
5 mg AS-60229-5 $242
Beta - Amyloid (16 - 20), HiLyte™ Fluor 555 - labeled, Human, mouse/rat
HiLyte™ Fluor 555 - KLVFF
1 mg AS-63305 $291
Beta - Amyloid (25 - 35), Human, mouse/rat
1 mg AS-24227 $49
Beta - Amyloid (25 - 35), Human, mouse/rat
5 mg AS-24228 $193
Beta - Amyloid (25 - 35), HiLyte™ Fluor 488 - labeled, Human, mouse/rat
HiLyte™ Fluor 488 - GSNKGAIIGLM
0.1 mg AS-63308 $110
[(trans,trans) - 1 - Bromo - 2,5 - bis - (3 - hydroxycarbonyl - 4 - hydroxy)styrylbenzene]
5 mg AS-88300 $121
BTA - 1
[2 - (4'' - (methylamino)phenyl)benzothiazole]
10 mg AS-88301 $66
C - PC (C - Phycocyanin) 1 mg AS-82003 $61
Chrysamine G 10 mg AS-88303 $66
CL - APC (Cross Linked - Allophycocyanin) 1 mg AS-82002 $61
Congo Red *UltraPure Grade* 1 g AS-83016 $66
R - PE (R - Phycoerythrin) 1 mg AS-82004 $61
SensoLyte® Fluorescent ß - Amyloid (1 - 40) Sampler Kit, Human 1 kit AS-72070 $374
SensoLyte® Fluorescent ß - Amyloid (1 - 42) Sampler Kit, Human 1 kit AS-72071 $374
SMCC Activated B - PE (B - Phycoerythrin) 1 mg AS-72109 $133
SMCC Activated CL - APC (Cross Linked - Allophycocyanin) 1 mg AS-72108 $133
SMCC Activated R - PE (R - Phycoerythrin) 1 mg AS-72110 $133
Thioflavin T *UltraPure Grade* 1 g AS-88306 $66
  < Back