Peptides  >  Hepatitis C Virus (HCV) Related Peptides
 Product Size Catalog # US$  
4A/4B, 5A/5B Peptide
Ac - DEMEECSMSY - NH2
Ac - DEMEECSMSY - NH2
5 mg 24487 $1017
HCV (Hepatitis C Virus) NS3/4A Protease Substrate
Ac - DE - Dap(QXL 520) - EE - Abu - ψ - [COO]AS - C(5 - FAMsp) - NH2
Ac - DE - Dap(QXL520) - EE - Abu - ψ - [
COO]AS - C(5 - FAMsp) - NH2
1 mg 60798 $726
HCV NS3/4A Protease Substrate Hydrolysis Product 1
Ac - DE - Dap(QXL 520) - EE - Abu
Ac - DE - Dap(QXL520) - EE - Abu
1 mg 60978 $545
HCV NS3/4A Protease Substrate Hydrolysis Product 2
Lac - SC(5 - FAMsp) - NH2
Lac - SC(5 - FAMsp) - NH2
1 mg 60979 $423
HCV Protease FRET Substrate (RET S1)
Ac - DE - D(Edans) - EE - Abu - ψ - [COO] - AS - K(Dabcyl) - NH2
Ac - DE - D(Edans) - EE - Abu - ψ - [COO] - AS - K(Dabcy
l) - NH2
0.25 mg 22991-025 $181
HCV Protease FRET Substrate (RET S1)
Ac - DE - D(Edans) - EE - Abu - ψ - [COO] - AS - K(Dabcy
l) - NH2
1 mg 22991 $583
HCV, NS4A - Like Peptide
KKGSVVIVGRIVLSGKPAIIPKK
KKGSVVIVGRIVLSGKPAIIPKK
1 mg 61710 $181
Hepatitis Virus C NS3 Protease Inhibitor 2
Ac - DE - Dif - E - Cha - C
Ac - DE - Dif - E - Cha - C
1 mg 25346 $423
Hepatitis Virus C NS3 Protease Inhibitor 2
Ac - DE - Dif - E - Cha - C
Ac - DE - Dif - E - Cha - C
5 mg 24489 $1271
Hepatitis Virus C NS3 Protease Inhibitor 4
Ac - DELE - Cha - C
Ac - DELE - Cha - C
1 mg 25348 $181
KK4A
KKGSVVIVGRIVLSGK
KKGSVVIVGRIVLSGK
5 mg 24491 $1017
NS4A - NS4B Hepatitis Virus C, NS3 Protease Inhibitor 1
Ac - DEMEEC
Ac - DEMEEC
1 mg 25345 $220
PEP1
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD - NH2
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD - NH2
1 mg 60430-1 $291
RET S1 Hydrolysis Product 1
Ac - DED(EDANS) - EEAbu
Ac - DED(EDANS) - EEAbu
1 mg 25334 $423
RET S1 Hydrolysis Product 2
Lac - SK(DABCYL) - NH2
Lac - SK(DABCYL) - NH2
1 mg 25132-1 $423
RET S1 Hydrolysis Product 2
Lac - SK(DABCYL) - NH2
Lac - SK(DABCYL) - NH2
5 mg 25132-5 $1694
  < Back