Peptides  >  Hepatitis C Virus (HCV) Related Peptides
 Product Size Catalog # US$  
HCV (Hepatitis C Virus) NS3/4A Protease Substrate
Ac - DE - Dap(QXL 520) - EE - Abu - ψ - [COO]AS - C(5 - FAMsp) - NH2
1 mg AS-60798 $726
HCV NS3/4A Protease Substrate Hydrolysis Product 1
Ac - DE - Dap(QXL 520) - EE - Abu
1 mg AS-60978 $545
HCV NS3/4A Protease Substrate Hydrolysis Product 2
Lac - SC(5 - FAMsp) - NH2
1 mg AS-60979 $423
HCV Protease FRET Substrate (RET S1)
Ac - DE - D(Edans) - EE - Abu - ψ - [COO] - AS - K(Dabcyl) - NH2
0.25 mg AS-22991-025 $181
HCV Protease FRET Substrate (RET S1) 1 mg AS-22991 $583
Hepatitis Virus C NS3 Protease Inhibitor 2
Ac - DE - Dif - E - Cha - C
1 mg AS-25346 $423
KK4A
KKGSVVIVGRIVLSGK
5 mg AS-24491 $1017
PEP1
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD - NH2
1 mg AS-60430-1 $291
RET S1 Hydrolysis Product 1
Ac - DED(EDANS) - EEAbu
1 mg AS-25334 $423
  < Back