Peptides  >  Cancer Research Peptides
 Product Size Catalog # US$  
[Asp370] - Tyrosinase (368 - 376)
YMDGTMSQV
1 mg 61456 $110
[pThr145] - p21 (140 - 147)
RKRRQ - pT - SM
1 mg 62613 $165
[Val165]NY - ESO - 1(157 - 165)
SLLMWITQV
1 mg 63823 $71
AH1 Sequence (6 - 14)
SPSYVYHQF
1 mg 64798 $77
Antennapedia Bak BH3 (Ant - BH3) (71 - 89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
1 mg 62262 $281
Apolipoprotein KV domain (67 - 77), KV11  NEW
YTMNPRKLFDY
1 mg 65477 $109
Bak BH3
GQVGRQLAIIGDDINR
1 mg 61616 $99
Bak BH3 (69 - 93)
STMGQVGRQLAIIGDDINRRYDSEF
1 mg 62272 $198
Bak BH3 peptide, TAMRA - labeled
5 - TAMRA - GQVGRQLAIIGDDINR
1 mg 64590 $237
Bax BH3 peptide (55 - 74), wild type
STKKLSECLKRIGDELDSNM
1 mg 62266 $121
Bcl - 2 Binding Peptide, Bad BH3 Peptide
LWAAQRYGRELRRMSDEFEGSFKGL
1 mg 64082 $198
BH3 BIM Peptide (52 - 71), human
Ac - MRPEIWIAQELRRIGDEFNA
1 mg 62439 $121
Bid BH3 Peptide
EDIIRNIARHLAQVGDSMDR
1 mg 61711 $121
Bid BH3, FAM labeled
5 - FAM - EDIIRNIARHLAQVGDSMDR
0.5 mg 61712 $303
Bid BH3, Peptide II, TAMRA labeled
5 - TAMRA - EDIIRNIARHLAQVGDSMDR
1 mg 62277 $181
Bid BH3 - R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg 62057 $231
Bid BH3 - r8
rrrrrrrr - GEDIIRNIARHLAQVGDSMDR
0.5 mg 61715 $363
Bid BH3 - R9
RRRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg 61713 $231
Bim BH3, Peptide III
DMRPEIWIAQELRRIGDEFNAYYAR
1 mg 62278 $198
Bim BH3, Peptide IV
DMRPEIWIAQELRRIGDEFNAYYARR
1 mg 62279 $203
c - Myc peptide epitope
EQKLISEEDL
1 mg 24194 $22
c - Myc peptide epitope
EQKLISEEDL
5 mg 20590 $99
CTT, Gelatinase Inhibitor
CTTHWGFTLC (Disulfide Bridge: 1 - 10)
1 mg 62054 $115
CXCL4/PF - 4 (47 - 70)  NEW
NGRKICLDLQAPLYKKIIKKLLES
1 mg 65474 $228
CXCL4L1/PF - 4var (47 - 70)  NEW
NGRKICLDLQALLYKKIIKEHLES
1 mg 65475 $228
Enhanced Green Fluorescent Protein, EGFP (200 - 208)
HYLSTQSAL
1 mg 65302 $77
Fibrinogen, 43 - 63  NEW
ARPAKAAATQKKVERKAPDA
1 mg 65476 $139
G209 - 2M, gp100 (209 - 217)
IMDQVPFSV
1 mg 61277 $110
GAD65 (206 - 220)
TYEIAPVFVLLEYVT
1 mg 61515 $110
gp100 (2533), human
KVPRNQDWL
1 mg 62589 $71
hACC1 (1258 - 1271), phosphorylated
DSPPQ - pS - PTFPEAGH
1 mg 63851 $181
HER - 2/neu pEC2 (420 - 429)
PDSLRDLSVF
1 mg 64837 $77
HIF - 1 {alpha} (556 - 574)
DLDLEMLAPYIPMDDDFQL
1 mg 61528 $127
IP3 peptide, (Lys)TAMRA labeled
MPRFMDYWEGLN - K(5/6 - TMR)
1 mg 61379 $220
Kisspeptin - 10 (Kp - 10), Metastin (110 - 119), amide, mouse, rat
YNWNSFGLRY - NH2
1 mg 64684 $55
Kisspeptin - 10 (Kp - 10), Metastin (45 - 54)
YNWNSFGLRF - NH2
1 mg 64240 $61
LyP - 1, Peptide 1
CGNKRTRGC (S - S Bonded)
1 mg 62169 $121
LyP - 1, Peptide 2
CGNKRTRGC
1 mg 62170 $121
MAGE - 3 (271 - 279)
FLWGPRALV
1 mg 61355 $44
MUC1, tandem repeat fragment
PDTRPAPGSTAPPAHGVTSA
1 mg 61451 $121
MUC5AC 3
GT - T* - PSPVPTTSTTSAP
1 mg 61334 $247
MUC5AC, Analog 1
GTTPSPVPTTSTTSAP
1 mg 61329 $99
MUC5AC - 13
GTTPSPVPTTST - T* - SAP
1 mg 61333 $247
MUC5AC - 3/13
GT - T* - PSPVPTTST - T* - SAP
1 mg 61332 $401
Neuropilin - 1 (NRP - 1) Antagonist; EG3287
SCKNTDSRCKARQLELNERTCRCDKPRR (Disulfide bridge 2 - 20 and 9 - 22)
1 mg 62840-1 $484
Neuropilin - 1 (NRP - 1) Antagonist; EG3287
SCKNTDSRCKARQLELNERTCRCDKPRR (Disulfide bridge 2 - 20 and 9 - 22)
0.5 mg 62840-05 $291
Noxa A BH3 peptide, cell permeable
rrrrrrrrGAELPPEFAAQLRKIGDKVYC
1 mg 64087 $303
Noxa BH3, Peptide 1
PAELEVECATQLRRFGDKLNFRQKLL
1 mg 62282 $198
Nuclear Factor (Erythroid - derived 2)like 2 (74 - 87); Nrf2 (74 - 87); NFE2L2 (74 - 87)
LQLDEETGEFLPIQ
5 mg 65341 $280
PDKtide, biotin labeled
Biotin - Ahx - KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
1 mg 64224 $385
Shepherdin (7987)
KHSSGCAFL
1 mg 62748 $71
Tachyplesin I  NEW
KWCFRVCYRGICYRRCR (Disulfide bonds: C1 - C4, C2 - C3)
1 mg 65478-1 $1350
Tachyplesin I  NEW
KWCFRVCYRGICYRRCR (Disulfide bonds: C1 - C4, C2 - C3)
0.5 mg 65478-05 $750
Tat - Pro ADAM10 (709 - 729)  NEW
YGRKKRRQRRRPKLPPPKPLPGTLKRRRPPQP
1 mg 65473 $258
Thrombospondin - derived Peptide; Cyclic CSVTCG
CSVTCG (S - S Bonded)
1 mg 65371 $95
TRP - 2 (180 - 188)
SVYDFFVWL
1 mg 61058 $93
TRP - 2, Tyrosinase - related Protein 2 (181 - 188)
VYDFFVWL
1 mg 64811 $71
VEGFR2/KDR Antagonist
ATWLPPR
1 mg 60628 $127
WP9QY, TNF - alpha Antagonist
YCWSQYLCY (Disulfide bridge: 2 - 8)
1 mg 62621 $132
  < Back