Peptides  >  Tag Peptides
 Product Size Catalog # US$  
3 x Hemagglutinin (HA) Tag
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
1 mg AS-63764 $347
Ac - Hexa His - Cys, Ac - HHHHHH - C
Ac - HHHHHHC
1 mg AS-65001 $71
DYKDDDDK
DYKDDDDK
5 mg AS-60738 $193
Glu - Glu epitope Tag
EYMPME
5 mg AS-62189 $143
HA 12CA5 Epitope
CYPYDVPDYA
1 mg AS-62229 $115
HA peptide
YPYDVPDYA
1 mg AS-21156 $49
HA peptide
YPYDVPDYA
5 mg AS-21158 $193
Hexa His
HHHHHH
1 mg AS-24420 $93
Hexa His
HHHHHH
5 mg AS-24421 $242
Rhodopsin Epitope Tag
TETSQVAPA
5 mg AS-62190 $193
V5 Epitope Tag
GKPIPNPLLGLDST
1 mg AS-61176 $83
  < Back