Peptides  >  Tag Peptides
 Product Size Catalog # US$  
3 x Hemagglutinin (HA) Tag
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
1 mg 63764 $347
3x DYKDDDDK Tag
DYKDDDDKDYKDDDDKDYKDDDDK
DYKDDDDKDYKDDDDKDYKDDDDK
1 mg 65144 $176
Ac - Hexa His - Cys, Ac - HHHHHH - C
Ac - HHHHHHC
Ac - HHHHHHC
1 mg 65001 $71
DYKDDDDK
DYKDDDDK
DYKDDDDK
5 mg 60738 $193
Glu - Glu epitope Tag
EYMPME
EYMPME
5 mg 62189 $143
HA 12CA5 Epitope
CYPYDVPDYA
CYPYDVPDYA
1 mg 62229 $115
HA peptide
YPYDVPDYA
YPYDVPDYA
1 mg 21156 $49
HA peptide
YPYDVPDYA
YPYDVPDYA
5 mg 21158 $193
Hexa His
HHHHHH
HHHHHH
1 mg 24420 $93
Hexa His
HHHHHH
HHHHHH
5 mg 24421 $242
Rhodopsin Epitope Tag
TETSQVAPA
TETSQVAPA
5 mg 62190 $193
V5 Epitope Tag
GKPIPNPLLGLDST
GKPIPNPLLGLDST
1 mg 61176 $83
  < Back