Peptides  >  Apoptosis Peptides
 Product Size Catalog # US$  
[Lys(Ac)373] - p53 (368 - 393), p53 K373(Ac), biotin - labeled, human
Biotin - KGGHLKSK - K(Ac) - GQSTSRHKKLMFKTEGPDSD - NH2
Biotin - KGGHLKSK - K(Ac) - GQSTSRHKKLMFKTEGPDSD - NH
2
1 mg 64865-1 $385
[Lys(Ac)373] - p53 (368 - 393), p53 K373(Ac), biotin - labeled, human
Biotin - KGGHLKSK - K(Ac) - GQSTSRHKKLMFKTEGPDSD - NH2
Biotin - KGGHLKSK - K(Ac) - GQSTSRHKKLMFKTEGPDSD - NH
2
0.25 mg 64865-025 $137
Ac - Gly - Pro - Leu - Asp - AMC
Ac - GPLD - AMC
Ac - GPLD - AMC
1 mg 64570-1 $143
Antennapedia Bak BH3 (Ant - BH3) (71 - 89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
1 mg 62262 $281
Bak BH3 (69 - 93)
STMGQVGRQLAIIGDDINRRYDSEF
STMGQVGRQLAIIGDDINRRYDSEF
1 mg 62272 $198
Bax BH3 peptide (55 - 74), wild type
STKKLSECLKRIGDELDSNM
STKKLSECLKRIGDELDSNM
1 mg 62266 $121
Bax H2 - H3 (53 - 86), Helix 2 - 3
DASTKKLSECLKRIGDELDSNMELQRMIAAVDTD
DASTKKLSECLKRIGDELDSNMELQRMIAAVDTD
1 mg 62283 $291
Bid BH3, Peptide II, TAMRA labeled
5 - TAMRA - EDIIRNIARHLAQVGDSMDR
5 - TAMRA - EDIIRNIARHLAQVGDSMDR
1 mg 62277 $181
Bid BH3 - R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg 62057 $231
Biotin - Caspase 1 Inhibitor II
Biotin - YVAD - CMK
Biotin - YVAD - CMK
1 mg 60841 $55
Caspase 1 (ICE) Inhibitor I
Ac - YVAD - CHO
Ac - YVAD - CHO
5 mg 25277-5 $242
Caspase 1 (ICE) Substrate 1m, fluorogenic
Ac - YEVD - AMC
5 mg 25267-5 $154
Caspase 1 (ICE) Substrate 2, chromogenic
Ac - YVAD - pNA
5 mg 25259-5 $105
Caspase 1 (ICE) Substrate 2f, fluorogenic
Ac - YVAD - AFC
5 mg 25271-5 $181
Caspase 1 (ICE) Substrate 2f, fluorogenic
Ac - YVAD - AFC
25 mg 25271-25 $726
Caspase 1 (ICE) Substrate 2m, fluorogenic
Ac - YVAD - AMC
25 mg 25261-25 $605
Caspase 1 (ICE) Substrate 2m, fluorogenic
Ac - YVAD - AMC
5 mg 25261-5 $154
Caspase 1 (ICE) Substrate 2r, fluorogenic
(Ac - YVAD)2 - Rh110
1 mg 60310-1 $154
Caspase 1 (ICE) Substrate 3f, fluorogenic
Ac - WEHD - AFC
5 mg 25285-5 $181
Caspase 1 (ICE) Substrate 3f, fluorogenic
Ac - WEHD - AFC
25 mg 25285-25 $726
Caspase 1 (ICE) Substrate 3m, fluorogenic
Ac - WEHD - AMC
25 mg 25275-25 $605
Caspase 1 Inhibitor 1 mg 60856 $55
Caspase 1 Inhibitor II
Ac - YVAD - CMK
Ac - YVAD - CMK
1 mg 60840 $66
Caspase 1 Inhibitor IV, Boc - D - CMK
Boc - D(OBzl) - CMK
Boc - D(OBzl) - CMK
5 mg 60864 $33
Caspase 1 Inhibitor VIII
Ac - WEHD - CHO
Ac - WEHD - CHO
1 mg 60863 $44
Caspase 1 Substrate III
Ac - WEHD - pNA
Ac - WEHD - pNA
1 mg 60843 $33
Caspase 2 (ICH - 1) Substrate 1m, fluorogenic
Ac - VDVAD - AMC
5 mg 25255-5 $154
Caspase 3 (Apopain) Inhibitor 1
Ac - DEVD - CHO
Ac - DEVD - CHO
5 mg 25269-5 $231
Caspase 3 (Apopain) Inhibitor 1
Ac - DEVD - CHO
Ac - DEVD - CHO
25 mg 25269-25 $847
Caspase 3 (Apopain) Inhibitor 1b
Biotin - DEVD - CHO
Biotin - DEVD - CHO
5 mg 25281-5 $242
Caspase 3 (Apopain) Substrate 1, chromogenic
Ac - DEVD - pNA
5 mg 25263-5 $83
Caspase 3 (Apopain) Substrate 1, chromogenic
Ac - DEVD - pNA
25 mg 25263-25 $303
Caspase 3 (Apopain) Substrate 1f, fluorogenic
Ac - DEVD - AFC
25 mg 25273-25 $726
Caspase 3 (Apopain) Substrate 1f, fluorogenic
Ac - DEVD - AFC
5 mg 25273-5 $181
Caspase 3 (Apopain) Substrate 1m, fluorogenic
Ac - DEVD - AMC
Ac - DEVD - AMC
5 mg 25262-5 $154
Caspase 3 (Apopain) Substrate 1m, fluorogenic
Ac - DEVD - AMC
Ac - DEVD - AMC
25 mg 25262-25 $605
Caspase 3 (Apopain) Substrate 1r - z, fluorogenic
(Z - DEVD)2 - Rh110
5 mg 60304-5 $350
Caspase 4 (ICH - 2) Substrate 1, chromogenic
Ac - LEVD - pNA
25 mg 25249-25 $413
Caspase 6 (Mch 2) Inhibitor 1
Ac - VEID - CHO
Ac - VEID - CHO
5 mg 25268-5 $231
Caspase 6 (Mch2) Substrate 1f, fluorogenic
Ac - VEID - AFC
5 mg 25272-5 $181
Caspase 6 (Mch2) Substrate 1m, fluorogenic
Ac - VEID - AMC
5 mg 25256-5 $154
Caspase 6 (Mch2) Substrate 1r, fluorogenic
(Ac - VEID)2 - Rh110
1 mg 60308-1 $154
Caspase 6 (Mch2) Substrate 2, fluorogenic
Mca - VQVDGW - K(Dnp) - NH2
Mca - VQVDGW - K(Dnp) - NH2
5 mg 25284-5 $242
Caspase 6 (Mch2) Substrate 2, fluorogenic
Mca - VQVDGW - K(Dnp) - NH2
Mca - VQVDGW - K(Dnp) - NH2
25 mg 25284-25 $847
Caspase 6 Substrate V, fluorogenic
Ac - VEHD - AFC
Ac - VEHD - AFC
1 mg 60862 $55
Caspase 8 Substrate 1, chromogenic
Ac - IETD - pNA
5 mg 25258-5 $105
Caspase 8 Substrate 1, chromogenic
Ac - IETD - pNA
25 mg 25258-25 $413
Caspase 8 Substrate 1f, fluorogenic
Ac - IETD - AFC
25 mg 25270-25 $726
Caspase 8 Substrate 1f, fluorogenic
Ac - IETD - AFC
5 mg 25270-5 $181
Caspase 8 Substrate 1f - z, fluorogenic
Z - IETD - AFC
5 mg 60324-5 $154
Caspase 8 Substrate 1m, fluorogenic
Ac - IETD - AMC
5 mg 25257-5 $154
Caspase 8 Substrate 1m, fluorogenic
Ac - IETD - AMC
25 mg 25257-25 $605
Caspase 8 Substrate 1r - z, fluorogenic
(Z - IEHD)2 - Rh110
(Z - IETD)2Rh110
5 mg 60312-5 $237
Caspase 8 Substrate 1r - z, fluorogenic
(Z - IETD)2 - Rh110
1 mg 60312-1 $154
Caspase 9 Substrate 1, chromogenic
Ac - LEHD - pNA
5 mg 25278-5 $105
Caspase 9 Substrate 1, chromogenic
Ac - LEHD - pNA
25 mg 25278-25 $413
Caspase 9 Substrate 1f, fluorogenic
Ac - LEHD - AFC
25 mg 25276-25 $726
Caspase 9 Substrate 1f, fluorogenic
Ac - LEHD - AFC
5 mg 25276-5 $181
Caspase 9 Substrate 1r, fluorogenic
(Ac - LEHD)2 - Rh110
1 mg 60306-1 $154
Caspase 9 Substrate 1r, fluorogenic
(Ac - LEHD)2 - Rh110
5 mg 60306-5 $215
Caspase 9 Substrate 2m, fluorogenic
Ac - LEHD - AMC
5 mg 25286-5 $181
Caspase 9 Substrate 2m, fluorogenic
Ac - LEHD - AMC
25 mg 25286-25 $726
Caspase Inhibitor II CHO
Ac - VAD - CHO
Ac - VAD - CHO
1 mg 60860 $33
ICE Inhibitor I, cell permeable
Ac - AAVLPAVLLALLAPYVAD - CHO
Ac - AAVLPAVLLALLAPYVAD - CHO
1 mg 60845 $154
LKKTETQ, Actin - Binding Domain
LKKTETQ
LKKTETQ
1 mg 63782 $71
PR39, Anti - Apoptotic Factor
RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP
RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP
0.5 mg 63688-05 $264
Pro - apoptotic Peptide, klaklakklaklak, 5 - FAM - labeled
5 - FAM - klaklakklaklak - NH2
5 - FAM - klaklakklaklak - NH2
1 mg 62206 $242
Proapoptotic Peptide, (klaklak)2
klaklakklaklak - NH2
klaklakklaklak - NH2
1 mg 62199 $110
PUMA BH3
EEQWAREIGAQLRRMADDLNAQYER
EEQWAREIGAQLRRMADDLNAQYER
1 mg 62404 $198
RGD - targeted Proapoptotic Peptide
ACDCRGDCFC - GG - klaklakklaklak - NH2 (S - S bonded C1 - C4 & C2 - C3)
ACDCRGDCFC - GG - klaklakklaklak - NH2 (S - S bonded C1 - C4 & C2 - C3)
1 mg 62207 $363
SensoLyte® 520 Generic Caspase Assay Kit *Fluorimetric*  NEW 1 kit 72211 $435
SensoLyte® AFC Caspase Profiling Kit *Fluorimetric* 1 kit 71116 $627
SensoLyte® AFC Caspase Substrate Sampler Kit *Fluorimetric* 1 kit 71117 $501
SensoLyte® AMC Caspase Profiling Kit *Fluorimetric* 1 kit 71120 $627
SensoLyte® AMC Caspase Substrate Sampler Kit *Fluorimetric* 1 kit 71121 $501
SensoLyte® Homogeneous AFC Caspase - 8 Assay Kit
200 assays (96 - well plate)
1 kit 72088-200 $374
SensoLyte® Homogeneous AFC Caspase - 8 Assay Kit
100 assays (96 - well plate)
1 kit 72088-100 $247
SensoLyte® Homogeneous AMC Caspase - 3/7 Assay Kit
500 assays (96 - well plate)
1 kit 71118 $272
SensoLyte® Homogeneous AnaRed Caspase - 3/7 Assay Kit
500 assays (96 - well plate)
1 kit 71122 $374
SensoLyte® Homogeneous Rh110 Caspase - 3/7 Assay Kit
500 assays (96 - well plate)
1 kit 71141 $272
SensoLyte® Homogeneous AFC Caspase - 3/7 Assay Kit
500 assays (96 - well plate)
1 kit 71114 $272
Smac N7 Protein
AVPIAQK
AVPIAQK
1 mg 60621 $115
Smac/Diablo Peptide [AVPIAQKSE], 5 - FAM labeled
AVPIAQKSEK - K(5 - FAM) - NH2
AVPIAQKSEK - K(5 - FAM) - NH2
1 mg 64758 $220
Smac/Diablo Peptide [AVPIAQKSE], biotin - labeled
AVPIAQKSEK - K(Biotin) - NH2
AVPIAQKSEK - K(Biotin) - NH2
1 mg 64729 $193
Z - DEVD - AFC 25 mg 21685-25 $726
Z - DEVD - AFC 5 mg 21685-5 $181
Z - DEVD - AMC
Z - DEVD - AMC
5 mg 60303-5 $181
  < Back