Peptides  >  Growth Factors
 Product Size Catalog # US$  
BMP - 2 Knuckle Epitope (73 - 92)
KIPKASSVPTELSAISTLYL
1 mg 64789 $110
EGF Receptor Substrate 2 [DADE - pY - LIPQQG]
DADE - pY - LIPQQG
5 mg 24434 $963
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], 5 - FAM labeled
5 - FAM - DADE - pY - LIPQQG
1 mg 29971-1 $303
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], 5 - FAM labeled
5 - FAM - DADE - pY - LIPQQG
5 mg 29971-5 $1215
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], Biotinylated
Biotin - DADE - pY - LIPQQG
1 mg 29972-1 $203
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ]
ADEYLIPQQ
1 mg 29942-1 $99
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ]
ADEYLIPQQ
5 mg 29942-5 $379
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ], 5 - FAM labeled
5 - FAM - ADEYLIPQQ
1 mg 29941-1 $237
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ], Biotinylated
Biotin - ADEYLIPQQ
1 mg 29936-1 $193
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ], Biotinylated
Biotin - ADEYLIPQQ
5 mg 29936-5 $759
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human
YADAIFTNSYRKVLGQLSARKLLQDIMSR - NH2
0.5 mg 22874 $77
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human
YADAIFTNSYRKVLGQLSARKLLQDIMSR - NH2
1 mg 22875 $121
Growth Hormone Releasing Factor, GRF (1 - 44), amide, bovine
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL - NH2
1 mg 20772 $264
  < Back