Peptides  >  ClearPoint™-Heavy Isotope Labeled and Related Peptides
 Product Size Catalog # US$  
ClearPoint Angiotensin I, human, 13C and 15N labeled
DR - V* - Y - I* - HPFHL [Val* = Val(U - 13C5,15N); Ile* = Ile(U - 13C6,15N)]
DR - V* - Y - I* - HPFHL [Val* = Val(U - 13C5,15N); Ile* = Ile(U - 13C6,15N)]
0.1 mg 65140 $77
ClearPoint Angiotensin II, human, 13C and 15N - labeled
DRVY - I* - HPF [I*= I(U13C6,15N)]
DRVY - I* - HPF [I*= I(U13C6,15N)]
0.1 mg 64805 $143
ClearPoint™ Angiotensin I, human, 13C and 15N - labeled
DRVY - I* - HPFHL [I*= I(U13C6,15N)]
DRVY - I* - HPFHL [I*= I(U13C6,15N)]
0.1 mg 61182 $143
ClearPoint™ beta - Amyloid (1 - 15), 13C, 15N - Arg, Human
DAEF - R* - HDSGYEVHHQ [R*=R(U - 13C6, U - 15N4)]
DAEF - R* - HDSGYEVHHQ [R*=R(U - 13C6, U - 15N4)]
0.05 mg 64495 $105
ClearPoint™ beta - Amyloid (1 - 15), 13C, 15N - labeled at Ala, Arg & Gly, Human
D - A* - EF - R* - HDS - G* - YEVHHQ [A*=A(U - 13C3, 15N); R*=R(U - 13C6, U - 15N4); G*=G(U - 13C2, 15N)]
D - A* - EF - R* - HDS - G* - YEVHHQ [A*=A(U - 13C3, 15N); R*=R(U - 13C6, U - 15N4); G*=G(U - 13C2, 15N)]
50 ug 64804 $110
ClearPoint™ beta - Amyloid (1 - 38), 13C - Phe & Ile, Human
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLMVGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLM
VGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
0.05 mg 65220 $117
ClearPoint™ beta - Amyloid (1 - 40), 13C, 15N - labeled at Arg & Lys, Human
DAEF - R* - HDSGYEVHHQ - K* - LVFFAEDVGSN - K* - GAIIGLMVGGVV [R*=R(U - 13C6, U - 15N4) & K*=K(U - 13C6, U - 15N2)]
DAEF - R* - HDSGYEVHHQ - K* - LVFFAEDVGSN - K* - GAIIGLMV
GGVV [R*=R(U - 13C6, U - 15N4) & K*=K(U - 13C6, U - 1
5N2)]
50 µg 63737 $143
ClearPoint™ beta - Amyloid (1 - 40), 13C, 15N - Leu 17,34, Human
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGVV [L*=L(U - 13C6, U - 15N)]
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGV
V [L*=L(U - 13C6, U - 15N)]
0.05 mg 64493 $143
ClearPoint™ beta - Amyloid (1 - 40), 13C - Leu, Human
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGVV L*=Leu(U - 13C6)
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGV
V L*=Leu(U - 13C6)
0.05 mg 65221 $117
ClearPoint™ beta - Amyloid (1 - 40), U - 13C - labeled at Leu17, Human
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIGLMVGGVV [L*=L(U - 13C6)]
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIGLMVGGVV [L*=L(U - 13C6)]
50 µg 63740 $115
ClearPoint™ beta - Amyloid (1 - 42), 13C, 15N - labeled at Arg & Lys, Human
DAEF - R* - HDSGYEVHHQ - K* - LVFFAEDVGSN - K* - GAIIGLMVGGVVIA [R*=R(U - 13C6, U - 15N4) & K*=K(U - 13C6, U - 15N2)]
DAEF - R* - HDSGYEVHHQ - K* - LVFFAEDVGSN - K* - GAIIGLMV
GGVVIA [R*=R(U - 13C6, U - 15N4) & K*=K(U - 13C6, U
- 15N2)]
50 µg 63738 $143
ClearPoint™ beta - Amyloid (1 - 42), 13C - Leu17,34, Human
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGVVIA [L*=L(U - 13C6)]
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGV
VIA [L*=L(U - 13C6)]
0.05 mg 64489 $143
ClearPoint™ beta - Amyloid (4 - 42), 13C, 15N - labeled at Arg & Lys, Human
F - R* - HDSGYEVHHQ - K* - LVFFAEDVGSN - K* - GAIIGLMVGGVVIA [R*=R(U - 13C6, U - 15N4) & K*=K(U - 13C6, U - 15N2)]
F - R* - HDSGYEVHHQ - K* - LVFFAEDVGSN - K* - GAIIGLMVGGV
VIA [R*=R(U - 13C6, U - 15N4) & K*=K(U - 13C6, U - 15
N2)]
50 µg 63739 $143
ClearPoint™ beta - Amyloid (8 - 42), U - 13C, 15N - labeled at Val12, Human
SGYE - V* - HHQKLVFFAEDVGSNKGAIIGLMVGGVVIA [V*=V(U - 13C5, U - 15N)]
SGYE - V* - HHQKLVFFAEDVGSNKGAIIGLMVGGVVIA [V*=V(U - 13C5, U - 15N)]
50 µg 63742 $115
ClearPoint™ BSA (347 - 359), Isotopic labeled, Mass Spec Standard
DAF - L* - GSF - L* - YEYSR [L* = L(U13C6, 15N)]
DAF - L* - GSF - L* - YEYSR [L* = L(U13C6, 15N)]
0.1 mg 61220 $171
ClearPoint™ C - Reactive Protein - Like Peptide, Isotopic labeled, Mass Spec Standard
GYSI - F* - SYATK [F* = F(U13C9, 15N)]
GYSI - F* - SYATK [F* = F(U13C9, 15N)]
0.1 mg 61219 $143
Peptide Mass Spec Standards 1 kit 60882 $99
Peptide Standard 1 for amino acid analysis
CPDFGHIAMELSVRTWKY
CPDFGHIAMELSVRTWKY
1 mg 22496 $215
Phosphopeptide Mass Spec Standards 1 kit 61145 $115
  < Back