Peptides  >  Histones  >  Histone H3 Peptides
Chromatin exist either as the transcriptionally active euchromatin or as the transcriptionally repressed heterchromatin state.1 Post-translational modifications of histone “tails” (amino termini) have been implicated in the conversion between the two states. 1-2 Covalent modifications, such as acetylation, methylation and phosphorylation affect chromatin structure and exquisitely regulate gene expression.3-6 Histone hyperacetylation is correlated with increased transcription, whereas hypoacetylation correlates with transcriptional repression.5 In Histone H3, preferential methylation sites have been shown to be Lys-4, Lys-9, Lys-27 and Lys-36, with methylation generally leading to transcriptional suppression.3,7 Phosphorylation at Ser10 (pSer10) is implicated in both transcription and cell division.8

AnaSpec, the world’s largest provider of on-demand GO™ peptides is pleased to announce the rapid expansion of our histone H3 peptide selection. These new Histone H3 GO™ Peptides include sequences that are acetylated, mono-, di- or tri-methylated, phosphorylated and biotinylated.

References:

1. Grunstein, M. et al. J. Cell Sci. Suppl. 19, 29 (1995).
2. Strahl, BR and CD Allis, Nature 403, 41 (2000).
3. Strahl, BD. et al. Proc. Natl. Acad. Sci. 96, 14967 (1999).
4. Jenuwein, T. and CD. Allis Science 293, 1074 (2001).
5. Sterner, DE. et al. Microbiol. Mol. Biol. Rev. 64, 435 (2000).
6. Lachner, M. et al. J. Cell Sci. 116, 2117 (2003).
7. Nishioka, K. et al. Genes & Dev. 16, 479 (2002).
8. Prigent, C. and S. Dimitrov, J. Cell Sci. 116, 3677 (2003).
 Product Size Catalog # US$  
Histone H3 (1 - 8)
ARTKQTAR
1 mg AS-65152 $71
Histone H3 (73 - 83)  NEW
EIAQDFKTDLR
1 mg AS-65437-1 $42
Histone H3 (73 - 83)  NEW
EIAQDFKTDLR
5 mg AS-65437-5 $104
[Lys(Ac)79] - Histone H3 (73 - 83), H3K79(Ac)  NEW
EIAQDF - K(Ac) - TDLR
1 mg AS-65438-1 $104
[Lys(Ac)79] - Histone H3 (73 - 83), H3K79(Ac)  NEW
EIAQDF - K(Ac) - TDLR
5 mg AS-65438-5 $259
[Lys(Me3)79] - Histone H3(73 - 83), H3K79(Me3)  NEW
EIAQDF - K(Me3) - TDLR
1 mg AS-65439-1 $102
[Lys(Me3)79] - Histone H3(73 - 83), H3K79(Me3)  NEW
EIAQDF - K(Me3) - TDLR
5 mg AS-65439-5 $357
[Lys(biotin)79] - Histone H3 (73 - 83), H3K79(biotin), Biotinylated  NEW
EIAQDF - K(biotin) - TDLR
0.25 mg AS-65440-025 $64
[Lys(biotin)79] - Histone H3 (73 - 83), H3K79(biotin), Biotinylated  NEW
EIAQDF - K(biotin) - TDLR
1 mg AS-65440-1 $128
[Lys(Ac)79] - Histone H3 (69 - 89), H3K79(Ac), biotin - labeled  NEW
RLVREIAQDF - K(Ac) - TDLRFQSSAV - K(biotin)
0.25 mg AS-65441-025 $163
[Lys(Ac)79] - Histone H3 (69 - 89), H3K79(Ac), biotin - labeled  NEW
RLVREIAQDF - K(Ac) - TDLRFQSSAV - K(biotin)
1 mg AS-65441-1 $325
[Lys(Ac)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
0.25 mg AS-65444-025 $167
[Lys(Ac)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
1 mg AS-65444-1 $335
[Lys(Ac)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
0.25 mg AS-65445-025 $250
[Lys(Ac)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
1 mg AS-65445-1 $501
[Lys(Me1)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me1),  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin
0.25 mg AS-65446-025 $200
[Lys(Me1)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me1),  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin
1 mg AS-65446-1 $401
[Lys(Me1)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
1 mg AS-65447-1 $190
[Lys(Me1)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
5 mg AS-65447-5 $440
[Lys(Me2)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
1 mg AS-65448-1 $240
[Lys(Me2)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
5 mg AS-65448-5 $540
[Lys(Me2)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
1 mg AS-65449-1 $190
[Lys(Me2)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
5 mg AS-65449-5 $440
[Lys(Me3)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
1 mg AS-65450-1 $240
[Lys(Me3)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
5 mg AS-65450-5 $540
[Lys(Me3)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
1 mg AS-65451-1 $270
[Lys(Me3)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
5 mg AS-65451-5 $620
[Lys(Me1)4] - Histone H3 (1 - 10), H3K4(Me1)
ART - K(Me1) - QTARKS
1 mg AS-64369-1 $176
[Lys(Me2)4] - Histone H3 (1 - 10), H3K4(Me2)
ART - K(Me2) - QTARKS
1 mg AS-64370-1 $176
[Lys(Me3)4] - Histone H3 (1 - 10), H3K4(Me3)
ART - K(Me3) - QTARKS
1 mg AS-64371-1 $176
[pSer10] - Histone H3 (1 - 15); H3pS10
ARTKQTARK - pS - TGGKA
0.5 mg AS-65128 $95
Histone H3 (1 - 18) - WC, amide
ARTKQTARKSTGGKAPRKWC - NH2
1 mg AS-65052 $110
[Lys(Ac)14] - Histone H3 (1 - 19), H3K14(Ac)
ARTKQTARKSTGG - K(Ac) - APRKQ
1 mg AS-63682 $181
Histone H3 (1 - 20), N - Terminal
ARTKQTARKSTGGKAPRKQL
1 mg AS-62753 $121
[Lys(Ac)9] - Histone H3 (1 - 20), H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQL
1 mg AS-63680 $181
Histone H3 (1 - 21), Biotinylated
ARTKQTARKSTGGKAPRKQLA - GG - K(BIOTIN) - NH2
1 mg AS-61702 $225
Histone H3 (1 - 21), FAM labeled
ARTKQTARKSTGGKAPRKQLAGG - K(FAM) - NH2
1 mg AS-63824 $313
Histone H3 (1 - 21), N - Terminal
ARTKQTARKSTGGKAPRKQLA
1 mg AS-61701 $176
Histone H3 (1 - 21) - Cys
ARTKQTARKSTGGKAPRKQLAC
1 mg AS-63789 $181
[Arg(Me1)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me1), biotin - labeled
A - R(Me1) - TKQTARKSTGGKAPRKQLAGG - K(Biotin) - NH2
0.25 mg AS-64629-025 $115
[Arg(Me1)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me1), biotin - labeled
A - R(Me1) - TKQTARKSTGGKAPRKQLAGG - K(Biotin) - NH2
1 mg AS-64629-1 $335
[Arg(Me2a)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me2a), biotin - labeled
A - R(Me2a) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg AS-64630-025 $143
[Arg(Me2a)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me2a), biotin - labeled
A - R(Me2a) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64630-1 $385
[Arg(Me2a)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65264-025 $145
[Arg(Me2a)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65264-1 $395
[Arg(Me2s)2] - Histone H3 (1 - 21) - GGK(Biotin); H3R2(Me2s), biotin - labeled
A - R(Me2s) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg AS-64631-025 $143
[Arg(Me2s)2] - Histone H3 (1 - 21) - GGK(Biotin); H3R2(Me2s), biotin - labeled
A - R(Me2s) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64631-1 $385
[Arg(Me2a)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65265-025 $159
[Arg(Me2a)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65265-1 $435
[Arg(Me2a)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65266-025 $159
[Arg(Me2a)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65266-1 $435
[Arg(Me2s)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65267-025 $159
[Arg(Me2s)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65267-1 $435
[Arg(Me2s)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65269-025 $159
[Arg(Me2s)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65269-1 $435
[Arg(Me2s)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65270-1 $435
[Arg(Me2s)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65270-025 $159
[Arg(Me2a)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65262-1 $395
[Arg(Me2a)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65262-025 $145
[Arg(Me2s)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65271-025 $159
[Arg(Me2s)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65271-1 $435
[Cit2] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - TKQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65237-025 $115
[Cit2] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - TKQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65237-1 $335
[Cit 2/8/17] - Histone H3 (1 - 21) - GGK(Biotin), amide
A - Cit - TKQTA - Cit - KSTGGKAP - Cit - KQLAGG - K(Biotin) - NH2
0.25 mg AS-65404 $250
[Cit2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65272-025 $143
[Cit2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65272-1 $385
[pThr3] - Histone H3 (1 - 21) - GGK(Biotin); H3pT3, biotin - labeled
AR - pT - KQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg AS-64612-025 $143
[pThr3] - Histone H3 (1 - 21) - GGK(Biotin); H3pT3, biotin - labeled
AR - pT - KQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64612-1 $385
[Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
ART - K(Ac) - QTARKSTGGKAPRKQLAGG - K(biotin)
0.25 mg AS-65207-025 $115
[Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
ART - K(Ac) - QTARKSTGGKAPRKQLAGG - K(biotin)
1 mg AS-65207-1 $335
Histone H3 (1 - 21), K4 methylated, FAM labeled
ART - K(Me) - QTARKSTGGKAPRKQLAGG - K(FAM) - NH2
1 mg AS-63825 $357
[Lys(Me1)4] - Histone H3 (1 - 21), H3K4(Me1)
ART - K(Me1) - QTARKSTGGKAPRKQLA
1 mg AS-64459 $297
[Lys(Me2)4] - Histone H3 (1 - 21), H3K4(Me2)
ART - K(Me2) - QTARKSTGGKAPRKQLA
1 mg AS-63677 $225
[Lys(Me3)4] - Histone H3 (1 - 21), H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLA
0.25 mg AS-64194-025 $115
[Lys(Me3)4] - Histone H3 (1 - 21), H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLA
1 mg AS-64194 $297
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me3), biotin labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64192 $319
[Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me1), biotin - labeled
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-64355-025 $115
[Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me1), biotin - labeled
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
1 mg AS-64355-1 $313
[Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me2), biotin - labeled
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-64356-025 $115
[Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me2), biotin - labeled
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
1 mg AS-64356-1 $286
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me3), biotin - labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-64357-025 $115
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me3), biotin - labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
1 mg AS-64357-1 $313
[Lys(Me3)4(Ac)9] - Histone H3 (1 - 21), H3K4(Me3)K9(Ac)
ART - K(Me3) - QTAR - K(Ac) - STGGKAPRKQLA
1 mg AS-64188 $325
[Lys(Me3)4(Ac)9] - Histone H3 (1 - 21), H3K4(Me3)K9(Ac), Biotin labeled
ART - K(Me3) - QTAR - K(Ac) - STGGKAPRKQLAGG - K(Biotin) - NH2
1 mg AS-64189 $357
[Lys (Me3) 4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA
0.25 mg AS-65422-025 $143
[Lys (Me3)4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA
1 mg AS-65422-1 $385
[Lys (Me3)4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21) - GGK(Biotin)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-65423-025 $145
[Lys (Me3)4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21) - GGK(Biotin)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA - GGK(Biotin)
1 mg AS-65423-1 $395
[Lys(Me3)4, Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ART - K(Me3) - QTARKSTGG - K(Ac) - APRKQLAGG - K(Biotin)
0.25 mg AS-65088-025 $143
[Lys(Me3)4, Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ART - K(Me3) - QTARKSTGG - K(Ac) - APRKQLAGG - K(Biotin)
1 mg AS-65088-1 $385
[Arg(Me1)8] - Histone H3 (1 - 21) - K(biotin), H3R8(Me1), biotin labeled
ARTKQTA - R(Me1) - KSTGGKAPRKQLA - K(Biotin) - NH2
0.25 mg AS-64607-025 $143
[Arg(Me1)8] - Histone H3 (1 - 21) - K(Biotin), H3R8(Me1), biotin labeled
ARTKQTA - R(Me1) - KSTGGKAPRKQLA - K(Biotin) - NH2
1 mg AS-64607-1 $385
[Arg(Me2a)8] - Histone H3(1 - 21) - K(Biotin), H3R8(Me2a), biotin - labeled
ARTKQTA - R(Me2a) - KSTGGKAPRKQLA - K(Biotin) - NH2
0.25 mg AS-64972-025 $143
[Arg(Me2a)8] - Histone H3(1 - 21) - K(Biotin), H3R8(Me2a), biotin - labeled
ARTKQTA - R(Me2a) - KSTGGKAPRKQLA - K(Biotin) - NH2
1 mg AS-64972-1 $385
[Arg(Me2s)8] - Histone H3 (1 - 21), biotin - labeled
ARTKQTA - R(Me2s) - KSTGGKAPRKQLA - K(Biotin)
1 mg AS-65351-1 $350
[Arg(Me2s)8] - Histone H3 (1 - 21), biotin - labeled
ARTKQTA - R(Me2s) - KSTGGKAPRKQLA - K(Biotin)
0.25 mg AS-65351-025 $130
[Cit8] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTA - Cit - KSTGGKAPRKQLAGG - K(Biotin)
0.25 mg AS-65232-025 $115
[Cit8] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTA - Cit - KSTGGKAPRKQLAGG - K(Biotin)
1 mg AS-65232-1 $335
[Lys(Ac)9] - Histone H3 (1 - 21), H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQLA
1 mg AS-64191 $203
[Lys(Ac)9] - Histone H3 (1 - 21) - NH2, H3K9(Ac), biotin - labeled, amide
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64190 $231
[Lys(Ac)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-64361-025 $115
[Lys(Ac)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
1 mg AS-64361-1 $247
[Lys(Ac)9, pSer10] - Histone H3 (1 - 21)
ARTKQTAR - K(Ac) - pS - TGGKAPRKQLA
0.25 mg AS-65203-025 $115
[Lys(Ac)9, pSer10] - Histone H3 (1 - 21)
ARTKQTAR - K(Ac) - pS - TGGKAPRKQLA
1 mg AS-65203-1 $335
[Lys(Ac)9/14] - Histone H3 (1 - 21) - GGK(Biotin), H3K9/14(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
0.25 mg AS-64363-025 $115
[Lys(Ac)9/14] - Histone H3 (1 - 21) - GGK(Biotin), H3K9/14(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
1 mg AS-64363-1 $253
[Lys(Me1)9] - Histone H3 (1 - 21), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin)
1 mg AS-65349-1 $305
[Lys(Me1)9] - Histone H3 (1 - 21), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin)
0.25 mg AS-65349-025 $105
[Lys(Me1)9] - Histone H3 (1 - 21) - K(Biotin), H3K9(Me1), biotin - labeled, amide
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin) - NH2
0.25 mg AS-64539 $115
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me1), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-64358-025 $115
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me1), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
1 mg AS-64358-1 $313
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin); H3K9(Me1), biotin - labeled, amide
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg AS-64626-025 $115
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin); H3K9(Me1), biotin - labeled, amide
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64626-1 $335
[Lys(Me2)9] - Histone H3 (1 - 21)
ARTKQTAR - K(Me2) - STGGKAPRKQLA
1 mg AS-65401 $210
[Lys(Me2)9] - Histone H3 (1 - 21) - K(Biotin), H3K9(Me2), biotin labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - K(Biotin)
1 mg AS-63678 $242
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-64359-025 $115
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin)
1 mg AS-64359-1 $286
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled, amide
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg AS-64627-025 $115
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled, amide
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64627-1 $335
[Lys(Me3)9] - Histone H3 (1 - 21), H3K9(Me3)
ARTKQTAR - K(Me3) - STGGKAPRKQLA
1 mg AS-64452 $225
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg AS-64360-025 $115
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
1 mg AS-64360-1 $313
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled, amide
ARTKQTAR - K(Me3) - STGGKAPRKQLAGG - K(Biotin) - NH2
0.25 mg AS-64628-025 $115
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled, amide
ARTKQTAR - K(Me3) - STGGKAPRKQLAGG - K(Biotin) - NH2
1 mg AS-64628-1 $335
[pSer10] - Histone H3 (1 - 21) - GGK(Biotin); H3pS10, biotin - labeled
ARTKQTARK - pS - TGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg AS-64611-025 $143
[pSer10] - Histone H3 (1 - 21) - GGK(Biotin); H3pS10, biotin - labeled
ARTKQTARK - pS - TGGKAPRKQLA - GGK(Biotin) - NH2
1 mg AS-64611-1 $385
[pSer10), Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ARTKQTARK - pS - TGG - K(Ac) - APRKQLAGGK(Biotin)
0.25 mg AS-64364-025 $115
[pSer10), Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ARTKQTARK - pS - TGG - K(Ac) - APRKQLAGGK(Biotin)
1 mg AS-64364-1 $291
[pThr11] - Histone H3(1 - 21) - GGK(Biotin), H3pT11, biotin - labeled
ARTKQTARKS - pT - GGKAPRKQLAGG - K(Biotin) - NH2
0.25 mg AS-64973-025 $105
[pThr11] - Histone H3(1 - 21) - GGK(Biotin), H3pT11, biotin - labeled
ARTKQTARKS - pT - GGKAPRKQLAGG - K(Biotin) - NH2
1 mg AS-64973-1 $325
[Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Ac), biotin - labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
0.25 mg AS-64362-025 $115
[Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Ac), biotin - labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
1 mg AS-64362-1 $247
[Lys(Me1)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me1), biotin - labeled
ARTKQTARKSTGG - K(Me1) - APRKQLAGG - K(Biotin) - NH2
0.25 mg AS-64974-025 $143
[Lys(Me1)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me1), biotin - labeled
ARTKQTARKSTGG - K(Me1) - APRKQLAGG - K(Biotin) - NH2
1 mg AS-64974-1 $385
[Lys(Me2)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me2), biotin - labeled
ARTKQTARKSTGG - K(Me2) - APRKQLAGG - K(Biotin) - NH2
0.25 mg AS-64971-025 $143
[Lys(Me2)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me2), biotin - labeled
ARTKQTARKSTGG - K(Me2) - APRKQLAGG - K(Biotin) - NH2
1 mg AS-64971-1 $385
[Lys(Me3)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Me3), biotin - labeled
ARTKQTARKSTGG - K(Me3) - APRKQLAGG - K(Biotin) - NH2
0.25 mg AS-64970-025 $115
[Lys(Me3)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Me3), biotin - labeled
ARTKQTARKSTGG - K(Me3) - APRKQLAGG - K(Biotin) - NH2
1 mg AS-64970-1 $313
[Arg(Me1)17] - Histone H3 (1 - 21) - GGK(Biotin), H3R17(Me1), biotin - labeled
ARTKQTARKSTGGKAP - R(Me1) - KQLA - GGK(Biotin) - NH2
0.25 mg AS-64632-025 $143
[Arg(Me1)17] - Histone H3 (1 - 21) - GGK(Biotin), H3R17(Me1), biotin - labeled
ARTKQTARKSTGGKAP - R(Me1) - KQLA - GGK(Biotin) - NH2
1 mg AS-64632-1 $385
[Arg(Me2a)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2a) - KQLA - GGK(Biotin) - NH2
0.25 mg AS-64634-025 $143
[Arg(Me2a)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2a) - KQLA - GGK(Biotin) - NH2
1 mg AS-64634-1 $385
[Arg(Me2a)17, Lys(Ac)18] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a)K14(Ac), biotin - labeled  NEW 0.25 mg AS-65414-025 $145
[Arg(Me2a)17, Lys(Ac)18] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a)K14(Ac), biotin - labeled  NEW 1 mg AS-65414-1 $395
[Arg(Me2s)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2s), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2s) - KQLA - GGK(Biotin) - NH2
0.25 mg AS-64633-025 $143
[Arg(Me2s)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2s), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2s) - KQLA - GGK(Biotin) - NH2
1 mg AS-64633-1 $385
[Cit17] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTARKSTGGKAP - Cit - KQLAGG - K(Biotin)
1 mg AS-65233-1 $335
[Cit17] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTARKSTGGKAP - Cit - KQLAGG - K(Biotin)
0.25 mg AS-65233-025 $115
[Lys(Ac)18] - Histone 3 (1 - 21) - GGK(Biotin); H3K18(Ac), biotin - labeled
ARTKQTARKSTGGKAPR - K(Ac) - QLA - GGK(Biotin) - NH2
0.25 mg AS-64638-025 $115
[Lys(Ac)18] - Histone 3 (1 - 21) - GGK(Biotin); H3K18(Ac), biotin - labeled
ARTKQTARKSTGGKAPR - K(Ac) - QLA - GGK(Biotin) - NH2
1 mg AS-64638-1 $335
[Lys(Me1)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me1), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me1) - QLA - GGK(Biotin) - NH2
0.25 mg AS-64621-025 $115
[Lys(Me1)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me1), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me1) - QLA - GGK(Biotin) - NH2
1 mg AS-64621-1 $335
[Lys(Me2)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me2), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me2) - QLA - GGK(Biotin) - NH2
0.25 mg AS-64620-025 $115
[Lys(Me2)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me2), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me2) - QLA - GGK(Biotin) - NH2
1 mg AS-64620-1 $335
[Lys(Me3)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me3), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me3) - QLAGG - K(Biotin) - NH2
0.25 mg AS-64622-025 $115
[Lys(Me3)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me3), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me3) - QLAGG - K(Biotin) - NH2
1 mg AS-64622-1 $335
[Lys(Ac)9] - Histone H3 (1 - 24), H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQLATKA
1 mg AS-64453 $181
[Lys(Me3)9] - Histone H3 (1 - 24), H3K9(Me3)
ARTKQTAR - K(Me3) - STGGKAPRKQLATKA
0.5 mg AS-63679 $181
[Lys(Ac)14/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLAT - K(Ac) - AGG - K(Biotin)
1 mg AS-65236-1 $385
[Lys(Ac)14/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLAT - K(Ac) - AGG - K(Biotin)
0.25 mg AS-65236-025 $132
[Lys(Ac)14/18/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AGG - K(Biotin)
1 mg AS-65235-1 $385
[Lys(Ac)14/18/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AGG - K(Biotin)
0.25 mg AS-65235-025 $132
Histone H3 (1 - 25), amide
ARTKQTARKSTGGKAPRKQLATKAA - NH2
1 mg AS-61703 $198
[Lys(Me3)4] - Histone H3 (1 - 25); H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLATKAA - NH2
1 mg AS-64636-1 $313
[Lys(Me3)4] - Histone H3 (1 - 25); H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLATKAA - NH2
0.25 mg AS-64636-025 $105
[Lys(Ac)14/18/23/27] - Histone H3 (1 - 30) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AAR - K(Ac) - SAPGG - K(Biotin)
0.25 mg AS-65227-025 $132
[Lys(Ac)14/18/23/27] - Histone H3 (1 - 30) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AAR - K(Ac) - SAPGG - K(Biotin)
1 mg AS-65227-1 $385
Histone H3(1 - 35)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
0.1 mg AS-65364-01 $180
Histone H3(1 - 35)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
0.25 mg AS-65364-025 $350
Histone H3 (1 - 50)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE
0.1 mg AS-65367-01 $280
Histone H3 (1 - 50)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE
0.25 mg AS-65367-025 $560
Histone H3 (1 - 50) - GGK(Biotin), biotin - labeled
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG - K(Biotin)
0.25 mg AS-65366-025 $580
Histone H3 (1 - 50) - GGK(Biotin), biotin - labeled
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG - K(Biotin)
0.1 mg AS-65366-01 $290
Histone H3 (1 - 55), biotin - labeled, acetylated
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ - K(LC - Biotin) - NH2
0.1 mg AS-65362-01 $300
Histone H3 (1 - 55), biotin - labeled, acetylated
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ - K(LC - Biotin) - NH2
0.25 mg AS-65362-025 $600
[Lys(Me1)9] - Histone H3 (3 - 17), H3K9(Me1)
TKQTAR - K(Me1) - STGGKAPR
1 mg AS-64372-1 $176
[Lys(Me2)9] - Histone H3 (3 - 17), H3K9(Me2)
TKQTAR - K(Me2) - STGGKAPR
1 mg AS-64373-1 $176
[Lys(Me3)9] - Histone H3 (3 - 17), H3K9(Me3)
TKQTAR - K(Me3) - STGGKAPR
1 mg AS-64374-1 $176
Histone H3 (5 - 23)
QTARKSTGGKAPRKQLASK
1 mg AS-65135 $105
[Lys(Ac)14] - Histone H3 (9 - 19), H3K14(Ac)
KSTGG - K(Ac) - APRKQ
1 mg AS-63681 $83
[Arg(Me1)26] - Histone H3 (15 - 36) - K(Biotin), H3R26(Me1), biotin labeled
APRKQLATKAA - R(Me1) - KSAPATGGVK - K(Biotin) - NH2
0.25 mg AS-64608-025 $143
[Arg(Me1)26] - Histone H3 (15 - 36) - K(Biotin), H3R26(Me1), biotin labeled
APRKQLATKAA - R(Me1) - KSAPATGGVK - K(Biotin) - NH2
1 mg AS-64608-1 $385
Histone H3 (15 - 36) - GGK(Biotin)  NEW 0.25 mg AS-65415-025 $115
Histone H3 (15 - 36) - GGK(Biotin)  NEW 1 mg AS-65415-1 $335
[Arg(Me2a)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2a), biotin labeled
APRKQLATKAA - R(Me2a) - KSAPATGGVKGG - K(Biotin)
0.25 mg AS-65261-025 $130
[Arg(Me2a)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2a), biotin labeled
APRKQLATKAA - R(Me2a) - KSAPATGGVKGG - K(Biotin)
1 mg AS-65261-1 $350
[Arg(Me2s)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2s), biotin labeled  NEW 0.25 mg AS-65416-025 $130
[Arg(Me2s)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2s), biotin labeled  NEW 1 mg AS-65416-1 $350
Histone H3 (15–39)
APRKQLATKAARKSAPATGGVKKPH
1 mg AS-61705 $220
[Lys(Me1)27] - Histone H3 (15 - 39) - K(Biotin), H3K27(Me1), biotin - labeled
APRKQLATKAAR - K(Me) - SAPATGGVKKPH - K(Biotin) - NH2
0.25 mg AS-64540 $115
[Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me2), biotin - labeled
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
0.25 mg AS-64442-025 $115
[Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me2), biotin - labeled
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
1 mg AS-64442-1 $335
[Lys(Me3)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me3), biotin - labeled
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
0.25 mg AS-64441-025 $115
[Lys(Me3)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me3), biotin - labeled
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
1 mg AS-64441-1 $335
Histone H3 (21 - 44)
ATKAARKSAPATGGVKKPHRYRPG
1 mg AS-64454-1 $193
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg AS-64440-025 $115
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
1 mg AS-64440-1 $335
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled, amide
ATKAARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
1 mg AS-64641-1 $335
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled, amide
ATKAARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
0.25 mg AS-64641-025 $115
[Lys(Ac)27] - Histone 3 (21 - 44) - GK(Biotin); H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
1 mg AS-64637-1 $335
[Lys(Ac)27] - Histone 3 (21 - 44) - GK(Biotin); H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
0.25 mg AS-64637-025 $115
[Lys(Me1)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me1), biotin - labeled
AT - K(Me1) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
1 mg AS-64617-1 $335
[Lys(Me1)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me1), biotin - labeled
AT - K(Me1) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
0.25 mg AS-64617-025 $115
[Lys(Me3)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me3), biotin - labeled
AT - K(Me3) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
1 mg AS-64619-1 $335
[Lys(Me3)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me3), biotin - labeled
AT - K(Me3) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
0.25 mg AS-64619-025 $115
[Lys(Me2)23] - Histone H3 (21 - 44) - GK(Biotin), H3K23(Me2), biotin - labeled
AT - K(Me2) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
1 mg AS-64618-1 $335
[Lys(Me2)23] - Histone H3 (21 - 44) - GK(Biotin), H3K23(Me2), biotin - labeled
AT - K(Me2) - AARKSAPSTGGVKKPHRYRPGG - K(Biotin) - NH2
0.25 mg AS-64618-025 $115
[Lys(Ac)27] - Histone H3 (21 - 43) - GGK(Biotin), H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPATGGVKKPHRYRPGG - K(Biotin)
1 mg AS-64846-1 $269
[Lys(Ac)27] - Histone H3 (21 - 43) - GGK(Biotin), H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPATGGVKKPHRYRPGG - K(Biotin)
0.25 mg AS-64846-025 $127
[Lys(Me1)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1), biotin - labeled
ATKAAR - K(Me1) - SAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg AS-64365-025 $115
[Lys(Me1)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1), biotin - labeled
ATKAAR - K(Me1) - SAPATGGVKKPHRYRPG - GK(Biotin)
1 mg AS-64365-1 $335
[Lys(Me2)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2), biotin - labeled
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg AS-64366-025 $115
[Lys(Me2)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2), biotin - labeled
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
1 mg AS-64366-1 $303
[Lys(Me3)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg AS-64367-025 $115
[Lys(Me3)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - GK(Biotin)
1 mg AS-64367-1 $335
[Lys(Ac)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Ac), biotin - labeled
ATKAARKSAPATGGV - K(Ac) - KPHRYRPGG - K(Biotin)
1 mg AS-64936-1 $335
[Lys(Ac)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Ac), biotin - labeled
ATKAARKSAPATGGV - K(Ac) - KPHRYRPGG - K(Biotin)
0.25 mg AS-64936-025 $115
[pSer28] - Histone H3 (21 - 44)
ATKAARK - pS - APSTGGVKKPHRYRPG
1 mg AS-65213-1 $297
[pSer28] - Histone H3 (21 - 44)
ATKAARK - pS - APSTGGVKKPHRYRPG
0.25 mg AS-65213-025 $99
[pSer28] - Histone H3 (21 - 44) - GK (Biotin), biotin - labeled
ATKAARK - pS - APATGGVKKPHRYRPGG - K(Biotin)
0.25 mg AS-65369-025 $105
[pSer28] - Histone H3 (21 - 44) - GK (Biotin), biotin - labeled
ATKAARK - pS - APATGGVKKPHRYRPGG - K(Biotin)
1 mg AS-65369-1 $305
[Cit26] - Histone H3 (21 - 44) - GGK(Biotin)
ATKAA - Cit - KSAPATGGVKKPHRYRPGGG - K(Biotin)
1 mg AS-65234-1 $335
[Cit26] - Histone H3 (21 - 44) - GGK(Biotin)
ATKAA - Cit - KSAPATGGVKKPHRYRPGGG - K(Biotin)
0.25 mg AS-65234-025 $115
[Lys(Ac)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Ac), biotin - labeled
AT - K(Ac) - AARKSAPATGGVKKPHRYRPGG - K(Biotin)
1 mg AS-65241-1 $335
[Lys(Ac)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Ac), biotin - labeled
AT - K(Ac) - AARKSAPATGGVKKPHRYRPGG - K(Biotin)
0.25 mg AS-65241-025 $115
[Lys(Ac)23] - Histone H3 (21 - 44)
AT - K(Ac) - AARKSAPSTGGVKKPHRYRPG
1 mg AS-65206-1 $297
[Lys(Ac)23] - Histone H3 (21 - 44)
AT - K(Ac) - AARKSAPSTGGVKKPHRYRPG
0.25 mg AS-65206-025 $99
[Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me1), biotin - labeled
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
0.25 mg AS-64368-025 $115
[Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me1), biotin - labeled
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
1 mg AS-64368-1 $335
[Lys(Me3)27] - Histone H3 (21 - 44), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - K(Biotin)
1 mg AS-65347-1 $305
[Lys(Me3)27] - Histone H3 (21 - 44), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - K(Biotin)
0.25 mg AS-65347-025 $105
Histone H3 (23 - 31)
KAARKSAPA
1 mg AS-65384 $80
Histone H3 (23 - 34)
KAARKSAPATGG
1 mg AS-64375-1 $99
Histone H3 (23 - 34) - Cys
KAARKSAPATGGC
1 mg AS-64398 $93
[Lys(Ac)27] - Histone H3 (23 - 34), H3K27(Ac)
KAAR - K(Ac) - SAPATGG
1 mg AS-65387 $75
[Lys(Me1)27] - Histone H3 (23 - 34), H3K27(Me1)
KAAR - K(Me1) - SAPATGG
1 mg AS-64376-1 $176
[Lys(Me2)27] - Histone H3 (23 - 34), H3K27(Me2)
KAAR - K(Me2) - SAPATGG
1 mg AS-64377-1 $176
[Lys(Me3)27] - Histone H3 (23 - 34), H3K27(Me3)
KAAR - K(Me3) - SAPATGG
1 mg AS-64378-1 $176
[Lys(Me3)27 - Histone H3 (23 - 34) - GGK(Biotin)
KAAR - K(Me3) - SAPATGGGG - K(Biotin)
1 mg AS-65397 $210
[Lys(Me1)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me1)
RKAAPATGGV - K(Me1) - KPHRYRPGTV - K(BIOTIN)
1 mg AS-64602-1 $335
[Lys(Me1)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me1)
RKAAPATGGV - K(Me1) - KPHRYRPGTV - K(BIOTIN)
0.25 mg AS-64602-025 $115
[Lys(Me3)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me3), biotin labeled, Orbitestella vera
RKAAPATGGV - K(Me3) - KPHRYRPGTV - K(BIOTIN)
1 mg AS-64600-1 $335
[Lys(Me3)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me3), biotin labeled, Orbitestella vera
RKAAPATGGV - K(Me3) - KPHRYRPGTV - K(BIOTIN)
0.25 mg AS-64600-025 $115
[Lys(Me2)36] - Histone H3 (26 - 46), H3K36(Me2)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)
1 mg AS-64601-1 $335
[Lys(Me2)36] - Histone H3 (26 - 46), H3K36(Me2)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)
0.25 mg AS-64601-025 $115
[Lys(Me1)36] - Histone H3 (31 - 41), H3K36(Me1)
STGGV - K(Me1) - KPHRY
1 mg AS-64379-1 $176
[Lys(Me2)36] - Histone H3 (31 - 41), H3K36(Me2)
STGGV - K(Me2) - KPHRY
1 mg AS-64380-1 $176
[Lys(Me3)36] - Histone H3 (31 - 41), H3K36(Me3)
STGGV - K(Me3) - KPHRY
1 mg AS-64381-1 $176
[Lys(Ac)56] - Histone H3 (44 - 63)
GTVALREIRRYQ - K(Ac) - STELLIR
1 mg AS-65204-1 $210
[Lys(Ac)56] - Histone H3 (44 - 63)
GTVALREIRRYQ - K(Ac) - STELLIR
0.25 mg AS-65204-025 $70
Histone H3 (44 - 63) - GGK(Biotin), biotin - labeled
GTVALREIRRYQKSTELLIR - GGK(Biotin) - NH2
1 mg AS-64642-1 $335
Histone H3 (44 - 63) - GGK(Biotin), biotin - labeled
GTVALREIRRYQKSTELLIR - GGK(Biotin) - NH2
0.25 mg AS-64642-025 $115
[Lys(Me1)79] - Histone H3 (58 - 89)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAI
1 mg AS-65223-1 $385
[Lys(Me1)79] - Histone H3 (58 - 89)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAI
0.25 mg AS-65223-025 $132
[Lys(Me1)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAIGG - K(Biotin)
0.25 mg AS-65224-025 $149
[Lys(Me1)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAIGG - K(Biotin)
1 mg AS-65224-1 $435
[Lys(Me2)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me2) - TDLRFQSAAIGG - K(Biotin)
0.25 mg AS-65228-025 $149
[Lys(Me2)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me2) - TDLRFQSAAIGG - K(Biotin)
1 mg AS-65228-1 $435
[Lys(Me3)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me3) - TDLRFQSAAIGG - K(Biotin)
1 mg AS-65250-1 $495
[Lys(Me3)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me3) - TDLRFQSAAIGG - K(Biotin)
0.25 mg AS-65250-025 $165
Histone H3 (69 - 89), H3K79, amide  NEW 1 mg AS-65425 $176
Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDFKTDLRFQSSAV - K(Biotin)
0.25 mg AS-65297-025 $83
Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDFKTDLRFQSSAV - K(Biotin)
1 mg AS-65297-1 $225
[Lys(Me2)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me2), biotin - labeled
RLVREIAQDF - K(Me2) - TDLRFQSSAV - K(Biotin)
0.25 mg AS-64544 $127
[Lys(Me1)79] - Histone H3 (69 - 89), H3K79(Me1), amide  NEW 0.25 mg AS-65426-025 $115
[Lys(Me1)79] - Histone H3 (69 - 89), H3K79(Me1), amide  NEW 1 mg AS-65426-1 $297
[Lys(Me1)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me1), biotin labeled
RLVREIAQDF - K(Me1) - TDLRFQSSAV - K(Biotin)
0.25 mg AS-64543 $127
[Lys(Me2)79] - Histone H3 (69 - 89), H3K79(Me2), amide  NEW 0.25 mg AS-65427-025 $115
[Lys(Me2)79] - Histone H3 (69 - 89), H3K79(Me2), amide  NEW 1 mg AS-65427-1 $297
[Lys(Me3)79] - Histone H3 (69 - 89), H3K79(Me3), amide  NEW 0.25 mg AS-65428-025 $115
[Lys(Me3)79] - Histone H3 (69 - 89), H3K79(Me3), amide  NEW 1 mg AS-65428-1 $297
[Lys(Me3)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me3), biotin labeled
RLVREIAQDF - K(Me3) - TDLRFQSSAV - K(biotin)
0.25 mg AS-64545-025 $127
[Lys(Me3)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me3), biotin labeled
RLVREIAQDF - K(Me3) - TDLRFQSSAV - K(biotin)
0.25 mg AS-64545-025 $127
[Lys(Me3)79,pThr80] - Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDF - K(Me3) - pT - DLRFQSSAV - K(Biotin)
1 mg AS-65300-1 $395
[Lys(Me3)79,pThr80] - Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDF - K(Me3) - pT - DLRFQSSAV - K(Biotin)
0.25 mg AS-65300-025 $140
Histone H3 (116–136), C116–136
KRVTIMPKDIQLARRIRGERA
1 mg AS-61704 $171
[Lys(Me1)9] - Histone H3 (1 - 21), H3K9(Me1)  NEW
ARTKQTAR - K(Me1) - STGGKAPRKQLA
1 mg AS-65398 $210
  < Back