Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptide Fragments
 Product Size Catalog # US$  
Beta - Amyloid (1 - 5) - Cys, Human
DAEFRC
DAEFRC
1 mg 64352 $93
Beta - Amyloid (1 - 8) - Cys, Human
DAEFRHDSC
DAEFRHDSC
1 mg 62132 $83
Beta - Amyloid (1 - 9), Human
DAEFRHDSG
DAEFRHDSG
1 mg 61970 $71
Beta - Amyloid (1 - 9), HiLyte™ Fluor 555 - labeled, Human
HiLyte™ Fluor 555 - DAEFRHDSG
HiLyte™ Fluor 555 - DAEFRHDSG
0.1 mg 63311 $154
Beta - Amyloid (1 - 9) - Lys(Biotin - LC) - NH2, Human
DAEFRHDSG - K(Biotin - LC) - NH2
DAEFRHDSG - K(Biotin - LC) - NH2
1 mg 61973 $105
Beta - Amyloid (1 - 10), Human
DAEFRHDSGY
DAEFRHDSGY
1 mg 64478 $61
Beta - Amyloid (1 - 10) - GG - K(Biotin), Human
DAEFRHDSGYGG - K(Biotin)
DAEFRHDSGYGG - K(Biotin)
1 mg 62134 $121
Beta - Amyloid (1 - 10) - Lys (Biotin), Human
DAEFRHDSGY - K(Biotin)
DAEFRHDSGY - K(Biotin)
1 mg 62135 $121
Beta - Amyloid (1 - 11), Human
DAEFRHDSGYE
DAEFRHDSGYE
1 mg 22819 $71
Beta - Amyloid (1 - 11), Human
DAEFRHDSGYE
DAEFRHDSGYE
5 mg 22820 $291
Beta - Amyloid (1 - 11), HiLyte™ Fluor 488 - labeled, Human
HiLyte™ Fluor 488 - DAEFRHDSGYE
HiLyte™ Fluor 488 - DAEFRHDSGYE
0.1 mg 63331 $93
Beta - Amyloid (1 - 12), Human
DAEFRHDSGYEV
DAEFRHDSGYEV
1 mg 62967 $83
Cys - beta - Amyloid (1 - 12), Human
CDAEFRHDSGYEV
CDAEFRHDSGYEV
1 mg 64353 $105
Beta - Amyloid (1 - 12) - Cys, Human
DAEFRHDSGYEVC
DAEFRHDSGYEVC
1 mg 65155 $71
Beta - Amyloid (1 - 12) - Cys - NH2, Human
DAEFRHDSGYEVC - NH2
DAEFRHDSGYEVC - NH2
1 mg 63333 $71
Beta - Amyloid (1 - 12) - Lys(Biotin) - NH2, Human
DAEFRHDSGYEV - K(Biotin) - NH2
DAEFRHDSGYEV - K(Biotin) - NH2
1 mg 62973 $121
Beta - Amyloid (1 - 13), Human
DAEFRHDSGYEVH
DAEFRHDSGYEVH
1 mg 64480 $83
Beta - Amyloid (1 - 14), Human
DAEFRHDSGYEVHH
DAEFRHDSGYEVHH
1 mg 64484 $88
Beta - Amyloid (1 - 15), Human
DAEFRHDSGYEVHHQ
DAEFRHDSGYEVHHQ
1 mg 61798 $93
Biotin - beta - Amyloid (1 - 15), Human
Biotin - DAEFRHDSGYEVHHQ
Biotin - DAEFRHDSGYEVHHQ
1 mg 62461 $121
Biotin - LC - beta - Amyloid (1 - 15), Human
Biotin - LC - DAEFRHDSGYEVHHQ
Biotin - LC - DAEFRHDSGYEVHHQ
1 mg 62970 $132
Beta - Amyloid (1 - 15) - Lys16(HiLyte™ Fluor 488), Human
DAEFRHDSGYEVHHQ - K(HiLyte™ Fluor 488)
0.5 mg 62002-05 $237
ClearPoint™ beta - Amyloid (1 - 15), 13C, 15N - Arg, Human
DAEF - R* - HDSGYEVHHQ [R*=R(U - 13C6, U - 15N4)]
DAEF - R* - HDSGYEVHHQ [R*=R(U - 13C6, U - 15N4)]
0.05 mg 64495 $105
Beta - Amyloid (1 - 16), Human
DAEFRHDSGYEVHHQK
DAEFRHDSGYEVHHQK
1 mg 24225 $83
Beta - Amyloid (1 - 16), Human
DAEFRHDSGYEVHHQK
DAEFRHDSGYEVHHQK
5 mg 24226 $341
[Gln11] - beta - Amyloid (1 - 16), Human
DAEFRHDSGYQVHHQK
DAEFRHDSGYQVHHQK
0.5 mg 25368 $71
[Gln11] - beta - Amyloid (1 - 16), Human
DAEFRHDSGYQVHHQK
DAEFRHDSGYQVHHQK
1 mg 25369 $110
Biotin - beta - Amyliod (1 - 16)
Biotin - DAEFRHDSGYEVHHQK
Biotin - DAEFRHDSGYEVHHQK
1 mg 62457 $121
Biotin - LC - beta - Amyloid (1 - 16), Human
Biotin - LC - DAEFRHDSGYEVHHQK
Biotin - LC - DAEFRHDSGYEVHHQK
1 mg 62458 $121
Beta - Amyloid (1 - 16) - Lys(Biotin - LC) - NH2, Human
DAEFRHDSGYEVHHQK - K(Biotin - LC) - NH2
DAEFRHDSGYEVHHQK - K(Biotin - LC) - NH2
1 mg 62136 $181
Beta - Amyloid (1 - 16), HiLyte™ Fluor 555 - labeled, Human
HiLyte™ Fluor 555 - DAEFRHDSGYEVHHQK
HiLyte™ Fluor 555 - DAEFRHDSGYEVHHQK
0.1 mg 63330 $137
Beta - Amyloid (1 - 17), Human
DAEFRHDSGYEVHHQKL
DAEFRHDSGYEVHHQKL
1 mg 61955 $110
Beta - Amyloid (1 - 17) - Cys, Human
DAEFRHDSGYEVHHQKLC
DAEFRHDSGYEVHHQKLC
1 mg 62473 $121
Beta - Amyloid (1 - 17), FAM - labeled, Human
5 - FAM - DAEFRHDSGYEVHHQKL
5 - FAM - DAEFRHDSGYEVHHQKL
0.1 mg 62952 $115
Beta - Amyloid (1 - 17), HiLyte™ Fluor 488 - labeled, Human
HiLyte™ Fluor 488 - DAEFRHDSGYEVHHQKL
HiLyte™ Fluor 488 - DAEFRHDSGYEVHHQKL
0.1 mg 62953 $115
Beta - Amyloid (1 - 20), Human
DAEFRHDSGYEVHHQKLVFF
DAEFRHDSGYEVHHQKLVFF
1 mg 62456 $121
Beta - Amyloid (1 - 22), Human
DAEFRHDSGYEVHHQKLVFFAE
DAEFRHDSGYEVHHQKLVFFAE
1 mg 62966 $181
Beta - Amyloid (1 - 24) - Cys, Human
DAEFRHDSGYEVHHQKLVFFAEDVC
DAEFRHDSGYEVHHQKLVFFAEDVC
1 mg 62475 $181
Beta - Amyloid (1 - 33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
0.5 mg 60250-05 $253
Beta - Amyloid (1 - 33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
1 mg 60250-1 $413
Beta - Amyloid (1 - 34), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
0.5 mg 61799 $176
Beta - Amyloid (1 - 36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
0.5 mg 60252-05 $264
Beta - Amyloid (1 - 36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
1 mg 60252-1 $423
Beta - Amyloid (1 - 37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
0.5 mg 60251-05 $264
Beta - Amyloid (1 - 37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
1 mg 60251-1 $423
Beta - Amyloid (1 - 38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg 24233 $154
Beta - Amyloid (1 - 38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg 24234 $275
ClearPoint™ beta - Amyloid (1 - 38), 13C - Phe & Ile, Human
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLMVGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLM
VGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
0.05 mg 65220 $117
Beta - Amyloid (1 - 39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg 24295 $181
Beta - Amyloid (1 - 39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
1 mg 24296 $335
Beta - Amyloid (1 - 41), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVI
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVI
1 mg 64559 $330
Beta - Amyloid (2 - 16), Human
AEFRHDSGYEVHHQK
AEFRHDSGYEVHHQK
1 mg 64794 $83
Beta - Amyloid (2 - 16) - Lys(Biotin - LC) - NH2, Human
AEFRHDSGYEVHHQK - K(Biotin - LC) - NH2
AEFRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64154 $99
Beta - Amyloid (2 - 17), Human
AEFRHDSGYEVHHQKL
AEFRHDSGYEVHHQKL
1 mg 64483 $110
Beta - Amyloid (3 - 16), Human
EFRHDSGYEVHHQK
EFRHDSGYEVHHQK
1 mg 64793 $77
Beta - Amyloid (3 - 16) - Lys(Biotin - LC) - NH2, Human
EFRHDSGYEVHHQK - K(Biotin - LC) - NH2
EFRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64155 $93
Beta - Amyloid (3 - 17), Human
EFRHDSGYEVHHQKL
EFRHDSGYEVHHQKL
1 mg 64482 $105
Cys - beta - Amyloid (4 - 10), Human
CFRHDSGY
CFRHDSGY
1 mg 61979 $71
Beta - Amyloid (4 - 13), Human
FRHDSGYEVH
FRHDSGYEVH
1 mg 62954 $77
Beta - Amyloid (4 - 16) - Lys(Biotin - LC) - NH2, Human
FRHDSGYEVHHQK - K(Biotin - LC) - NH2
FRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64156 $83
Beta - Amyloid (4 - 24), Human
FRHDSGYEVHHQKLVFFAEDV
FRHDSGYEVHHQKLVFFAEDV
1 mg 62961 $176
Beta - Amyloid (4 - 24) - Cys, Human
FRHDSGYEVHHQKLVFFAEDVC
FRHDSGYEVHHQKLVFFAEDVC
1 mg 63326 $176
Beta - Amyloid (4 - 16) - Lys(Biotin - LC) - NH2, Human
FRHDSGYEVHHQK - K(Biotin - LC) - NH2
FRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64156 $83
Beta - Amyloid (4 - 17), Human
FRHDSGYEVHHQKL
FRHDSGYEVHHQKL
1 mg 64475 $88
Beta - Amyloid (5 - 14), Human
RHDSGYEVHH
RHDSGYEVHH
1 mg 62965 $83
Beta - Amyloid (5 - 16) - Lys(Biotin - LC) - NH2, Human
RHDSGYEVHHQK - K(Biotin - LC) - NH2
RHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64157 $83
Beta - Amyloid (5 - 17), Human
RHDSGYEVHHQKL
RHDSGYEVHHQKL
1 mg 64481 $83
Beta - Amyloid (6 - 16) - Lys(Biotin - LC) - NH2, Human
HDSGYEVHHQK - K(Biotin - LC) - NH2
HDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64158 $83
Beta - Amyloid (6 - 17), Human
HDSGYEVHHQKL
HDSGYEVHHQKL
1 mg 64479 $77
Beta - Amyloid (6 - 30), Human
HDSGYEVHHQKLVFFAEDVGSNKGA
HDSGYEVHHQKLVFFAEDVGSNKGA
1 mg 62888 $203
Beta - Amyloid (7 - 22), Human
DSGYEVHHQKLVFFAE
DSGYEVHHQKLVFFAE
1 mg 61803 $99
Beta - Amyloid (8 - 17), Human
SGYEVHHQKL
SGYEVHHQKL
1 mg 64477 $61
Beta - Amyloid (9 - 27), Human
GYEVHHQKLVFFAEDVGSN
GYEVHHQKLVFFAEDVGSN
1 mg 62886 $115
Biotin - LC - beta - Amyloid (10 - 20), Human
Biotin - LC - YEVHHQKLVFF
Biotin - LC - YEVHHQKLVFF
1 mg 62972 $121
Beta - Amyloid (10 - 19), Human
YEVHHQKLVF
YEVHHQKLVF
1 mg 62963 $77
Beta - Amyloid (10 - 20), Human
YEVHHQKLVFF
YEVHHQKLVFF
0.5 mg 25364 $39
Beta - Amyloid (10 - 20), Human
YEVHHQKLVFF
YEVHHQKLVFF
1 mg 25365 $61
Beta - Amyloid (10 - 26), Human
YEVHHQKLVFFAEDVGS
YEVHHQKLVFFAEDVGS
1 mg 62885 $105
Beta - Amyloid (10 - 35), Human
YEVHHQKLVFFAEDVGSNKGAIIGLM
YEVHHQKLVFFAEDVGSNKGAIIGLM
1 mg 61931 $181
Beta - Amyloid (10 - 35) - Lys(Biotin) - NH2, Human
YEVHHQKLVFFAEDVGSNKGAIIGLM - K(Biotin) - NH2
YEVHHQKLVFFAEDVGSNKGAIIGLM - K(Biotin) - NH2
0.1 mg 63745 $121
Beta - Amyloid (11 - 17), Human
EVHHQKL
EVHHQKL
1 mg 63819 $71
Beta - Amyloid (11 - 22), Human
EVHHQKLVFFAE
EVHHQKLVFFAE
1 mg 23956 $99
Beta - Amyloid (11 - 22), Human
EVHHQKLVFFAE
EVHHQKLVFFAE
5 mg 23957 $401
DABCYL - beta - Amyloid (11 - 22) - EDANS, Human
DABCYL - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - EDANS
DABCYL - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Ph
e - Ala - Glu - EDANS
1 mg 23551 $264
Beta - Amyloid (11 - 25), Human
EVHHQKLVFFAEDVG
EVHHQKLVFFAEDVG
1 mg 62884 $93
β - Amyloid (12 - 24), Human
VHHQKLVFFAEDV
VHHQKLVFFAEDV
1 mg 62883 $83
β - Amyloid (13 - 23), Human
HHQKLVFFAED
HHQKLVFFAED
1 mg 62882 $77
Beta - Amyloid (13 - 28), Human
HHQKLVFFAEDVGSNK
HHQKLVFFAEDVGSNK
1 mg 61802 $99
Acetyl - beta - Amyloid (15 - 20), Human, mouse/rat
Ac - QKLVFF
Ac - QKLVFF
5 mg 60227-5 $291
Beta - Amyloid (15 - 21), Human, mouse/rat
QKLVFFA
QKLVFFA
1 mg 60228-1 $71
Beta - Amyloid (15 - 21), Human, mouse/rat
QKLVFFA
QKLVFFA
5 mg 60228-5 $291
Beta - Amyloid (15 - 25), Human, mouse/rat
QKLVFFAEDVG
QKLVFFAEDVG
1 mg 62906 $77
Beta - Amyloid (15 - 26) - Lys(Biotin) - NH2, Human, mouse/rat
QKLVFFAEDVGS - K(Biotin) - NH2
QKLVFFAEDVGS - K(Biotin) - NH2
0.5 mg 62469 $121
Biotin - LC - beta - Amyloid (15 - 25), Human, mouse/rat
Biotin - LC - QKLVFFAEDVG
Biotin - LC - QKLVFFAEDVG
1 mg 62907 $115
Beta - Amyloid (15 - 36), Human, mouse/rat
QKLVFFAEDVGSNKGAIIGLMV
QKLVFFAEDVGSNKGAIIGLMV
1 mg 62023 $242
Beta - Amyloid (16 - 20), Human, mouse/rat
KLVFF
KLVFF
1 mg 60229-1 $61
Beta - Amyloid (16 - 20), Human, mouse/rat
KLVFF
KLVFF
5 mg 60229-5 $242
Beta - Amyloid (16 - 20), HiLyte™ Fluor 555 - labeled, Human, mouse/rat
HiLyte™ Fluor 555 - KLVFF
HiLyte™ Fluor 555 - KLVFF
1 mg 63305 $291
[Ac - Lys(Me)16, N - Me - Val18] - beta - Amyloid (16 - 20) - NH2, Human, mouse/rat
Ac - K(Me) - L - (N - Me - V) - FF - NH2
Ac - K(Me) - L - (N - Me - V) - FF - NH2
1 mg 61344 $132
Beta - Amyloid (16 - 22), Human, mouse/rat
KLVFFAE
KLVFFAE
1 mg 62897 $71
Beta - Amyloid (16 - 23), Human, mouse/rat
KLVFFAED
KLVFFAED
1 mg 61801 $61
Beta - Amyloid (16 - 24), Human, mouse/rat
KLVFFAEDV
KLVFFAEDV
1 mg 62139 $61
Beta - Amyloid (16 - 26), Human, mouse/rat
KLVFFAEDVGS
KLVFFAEDVGS
1 mg 61804 $77
Beta - Amyloid (17 - 21), Human, mouse/rat
LVFFA
LVFFA
1 mg 60230-1 $61
Beta - Amyloid (17 - 21) - Lys(Biotin), Human, mouse/rat
LVFFA - K(Biotin)
LVFFA - K(Biotin)
1 mg 62467 $143
[Pro18, Asp21] - beta - Amyloid (17 - 21), iAb5, Human, mouse/rat
LPFFD
LPFFD
1 mg 60618 $105
Acetyl [Pro18, Asp21] - beta - Amyloid (17 - 21), amide, iAb5p Pro18 Asp21, Human, mouse/rat
Ac - LPFFD - NH2
Ac - LPFFD - NH2
1 mg 61174 $66
Acetyl - [Pro18, NMePhe19] - beta - Amyloid (17 - 21), amide, iAb5p - A1, Human, mouse/rat
Ac - LP - (NMe - F) - FD - NH2
Ac - LP - (NMe - F) - FD - NH2
1 mg 60620 $143
Beta - Amyloid (17 - 24), Human, mouse/rat
LVFFAEDV
LVFFAEDV
1 mg 61978 $71
Biotin - beta - Amyloid (17 - 24), Human, mouse/rat
BIOTIN - LVFFAEDV
BIOTIN - LVFFAEDV
1 mg 61980 $83
Biotin - LC - beta - Amyloid (18 - 28), Human, mouse/rat
Biotin - LC - VFFAEDVGSNK
Biotin - LC - VFFAEDVGSNK
1 mg 62971 $121
Acetyl - beta - Amyloid (20 - 29), amide, Human, mouse/rat
Ac - FAEDVGSNKG - NH2
Ac - FAEDVGSNKG - NH2
1 mg 60231-1 $66
Acetyl - beta - Amyloid (20 - 29), amide, Human, mouse/rat
Ac - FAEDVGSNKG - NH2
Ac - FAEDVGSNKG - NH2
5 mg 60231-5 $264
Beta - Amyloid (22 - 35), Human, mouse/rat
EDVGSNKGAIIGLM
EDVGSNKGAIIGLM
1 mg 22823 $115
Beta - Amyloid (22 - 35), Human, mouse/rat
EDVGSNKGAIIGLM
EDVGSNKGAIIGLM
5 mg 22824 $462
Biotin - LC - beta - Amyloid (22 - 41), Human, mouse/rat
Biotin - LC - EDVGSNKGAIIGLMVGGVVI
Biotin - LC - EDVGSNKGAIIGLMVGGVVI
1 mg 62455 $198
Beta - Amyloid (23 - 37), Human, mouse/rat
DVGSNKGAIIGLMVG
DVGSNKGAIIGLMVG
1 mg 62761 $93
Beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGLM
GSNKGAIIGLM
1 mg 24227 $49
Beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGLM
GSNKGAIIGLM
5 mg 24228 $193
Beta - Amyloid (25 - 35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
GSNKGAIIGLM • HCl
1 mg 21647 $77
Beta - Amyloid (25 - 35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
GSNKGAIIGLM • HCl
5 mg 23212 $313
Beta - Amyloid (25 - 35), scrambled, Human, mouse/rat
MAKGINGISGL
MAKGINGISGL
1 mg 61971 $71
[Nle35] - beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGL - Nle
GSNKGAIIGL - Nle
1 mg 22976 $71
[Nle35] - beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGL - Nle
GSNKGAIIGL - Nle
5 mg 22977 $291
Beta - Amyloid (25 - 35), HiLyte™ Fluor 488 - labeled, Human, mouse/rat
HiLyte™ Fluor 488 - GSNKGAIIGLM
HiLyte™ Fluor 488 - GSNKGAIIGLM
0.1 mg 63308 $110
Biotin - beta - Amyloid (25 - 35), Human, mouse/rat
Biotin - GSNKGAIIGLM
Biotin - GSNKGAIIGLM
1 mg 62451 $105
Beta - Amyloid (26 - 37), Human, mouse/rat
SNKGAIIGLMVG
SNKGAIIGLMVG
1 mg 62920 $83
Beta - Amyloid (26 - 39), Human, mouse/rat
SNKGAIIGLMVGGV
SNKGAIIGLMVGGV
1 mg 62916 $99
Beta - Amyloid (29 - 38), Human, mouse/rat
GAIIGLMVGG
GAIIGLMVGG
1 mg 62923 $77
ch Beta - Amyloid (30 - 16)
CTFVRTHIFCKEHQF
CTFVRTHIFCKEHQF
1 mg 61639 $99
Beta - Amyloid (30–34), Human, mouse/rat
AIIGL
AIIGL
1 mg 61977 $77
Beta - Amyloid (31 - 35), Human, mouse/rat
IIGLM
IIGLM
1 mg 25360 $39
Beta - Amyloid (32 - 35), Human, mouse/rat
IGLM
IGLM
1 mg 25362 $39
Beta - Amyloid (32 - 35), Human, mouse/rat
IGLM
IGLM
5 mg 25363 $99
Beta - Amyloid (35 - 25), Human, mouse/rat
MLGIIAGKNSG
MLGIIAGKNSG
0.5 mg 25366 $71
Beta - Amyloid (35 - 25), Human, mouse/rat
MLGIIAGKNSG
MLGIIAGKNSG
1 mg 25367 $110
Beta - Amyloid (35 - 43), Human, mouse/rat
MVGGVVIAT
MVGGVVIAT
1 mg 62759 $71
Beta - Amyloid (36 - 45), Human, mouse/rat
VGGVVIATVI
VGGVVIATVI
1 mg 63750 $66
Beta - Amyloid (37 - 43), Human, mouse/rat
GGVVIAT
GGVVIAT
1 mg 61030 $71
Beta - Amyloid (40 - 1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg 22817 $193
Beta - Amyloid (40 - 1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg 22818 $325
  < Back