Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptides - Mouse/Rat
 Product Size Catalog # US$  
Beta - Amyloid Peptide (1 - 42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
0.5 mg 25381 $341
Beta - Amyloid Peptide (1 - 42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
1 mg 25231 $545
Biotin - LC - beta - Amyloid (1 - 42), mouse, rat
Biotin - LC - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
0.1 mg 61718-01 $159
Beta - Amyloid Peptide (1 - 40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 25380 $264
Beta - Amyloid Peptide (1 - 40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 25230 $423
Biotin - LC - beta - Amyloid (1 - 40), mouse, rat
Biotin - LC - DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 61717-01 $110
Beta - Amyloid (1 - 40) - Lys(Biotin) - NH2, mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - K(Biotin) - NH2
0.1 mg 63356 $165
Beta - Amyloid (1 - 38), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg 62476 $423
Beta - Amyloid (1 - 16), mouse, rat
DAEFGHDSGFEVRHQK - NH2
1 mg 60889-1 $83
Beta - Amyloid (1 - 16), mouse, rat
DAEFGHDSGFEVRHQK - NH2
5 mg 60889-5 $341
Beta - Amyloid (11 - 40), mouse, rat
EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 62997 $303
  < Back