GMP Peptides
Custom GMP* Peptides

With Over 25 years of experience and ingenuity in peptide synthesis, we have forged a reputation of trust with our customers in the production of highly complex peptides. By combining innovation with quality, we extend our RUO custom peptide know-how to GMP manufacturing. Each GMP peptide is produced in our ISO 7 classified clean room (10,000) and follows a stringent QC process.


Catalog GMP* Peptides
Now offering the only GMP beta-amyloid peptides on the market
For added assurance of your high profile projects related to Alzheimer's Disease, we now offer GMP grade beta-Amyloid (human) 1-40 and 1-42 catalog peptides for immediate use. Testing of these peptides goes beyond the standard purity and mass spectrometry, by reporting results for Bioburden, Endotoxin, and Monomer content.
RELEASE TESTING ON CoA
  • Endotoxin
  • Bioburden
  • Solubility
  • Monomer Content
  • Water Content
  • Mass Spectrometry
  • Peptide Purity
  • Amino Acid Analysis
  • Peptide Content
 Product Size Catalog # US$  
GMP beta-Amyloid (1-42), human (Ammonium Salt)
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
5mg AS-GMP-20276-5 $3,590
GMP beta-Amyloid (1-42), human (Ammonium Salt)
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
1mg AS-GMP-20276-1 $756
GMP beta-Amyloid (1-40), human (Ammonium Salt)
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
5mg AS-GMP-24236-5 $2,420
GMP beta-Amyloid (1-40), human (Ammonium Salt)
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
1mg AS-GMP-24236-1 $509
   

* Not to be used as an API in it's current form.