New Products from AnaSpec
 Total # of New Products: 6    

  Cancer Research Peptides
 Product Size Catalog # US$  
Human PD - L1 inhibitor I  NEW 1 mg AS-65581 $155
Human PD - L1 inhibitor II  NEW 1 mg AS-65582 $155
Human PD - L1 inhibitor III  NEW 1 mg AS-65583 $155
  Mitochondrial Peptides
 Product Size Catalog # US$  
MOTS - c  NEW
H - MRWQEMGYIFYPRKLR - OH
1 mg AS-65587 $149
SHLP1 (Small humanin - like peptide 1)  NEW
H - MCHWAGGASNTGDARGDVFGKQAG - OH
1 mg AS-65588 $381
SHLP3 (Small humanin - like peptide 3)  NEW
H - MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW - OH
0.1 mg AS-65589 $118
  Nesfatins
 Product Size Catalog # US$  
Nesfatin - 1 (24 - 53), human  NEW 0.5 mg AS-65571 $188
Nesfatin - 1 (24 - 53), mouse  NEW 0.5 mg AS-65572 $188
  Neurogranin
 Product Size Catalog # US$  
biotin - Neurogranin (48 - 76), human  NEW 1 mg AS-65576 $348
biotin - Neurogranin (48 - 76), mouse  NEW 1 mg AS-65577 $348
Neurogranin (48 - 76), human  NEW 1 mg AS-65575 $341
  Orexins
 Product Size Catalog # US$  
Orexin B, human  NEW 1 mg AS-65573 $255
Orexin B, mouse  NEW 1 mg AS-65574 $255
  Spexin
 Product Size Catalog # US$  
Spexin (36 - 49), amidated, human/mouse/rat  NEW 1 mg AS-65569 $125
Spexin - 2 (53 - 70), amidated, human/mouse/rat  NEW 1 mg AS-65570 $249
Spexin - 2 (53 - 70), human/mouse/rat  NEW 1 mg AS-65586 $249
 Total # of New Products: 6