New Products from AnaSpec
 Total # of New Products: 1    

  Mitochondrial Peptides
 Product Size Catalog # US$  
MOTS - c  NEW
H - MRWQEMGYIFYPRKLR - OH
1 mg AS-65587 $149
SHLP1 (Small humanin - like peptide 1)  NEW
H - MCHWAGGASNTGDARGDVFGKQAG - OH
1 mg AS-65588 $381
SHLP3 (Small humanin - like peptide 3)  NEW
H - MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW - OH
0.1 mg AS-65589 $118
 Total # of New Products: 1