Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Scrambled-beta-Amyloid (1-40), Human

Product Name Scrambled - beta - Amyloid (1 - 40), Human
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Size 1 mg
Catalog # AS-24626
US$ $335
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20░C
Molecular Weight 4329.9
Sequence
(One-Letter Code)
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Sequence
(Three-Letter Code)
H - Ala - Glu - Gly - Asp - Ser - His - Val - Leu - Lys - Glu - Gly - Ala - Tyr - Met - Glu - Ile - Phe - Asp - Val - Gln - Gly - His - Val - Phe - Gly - Gly - Lys - Ile - Phe - Arg - Val - Val - Asp - Leu - Gly - Ser - His - Asn - Val - Ala - OH
Product Citations Maneshi, MM. et al. (2018). Enantiomeric Aβ peptides inhibit the fluid shear stress response of PIEZO1.áSci Repá8(1):14267. doi: 10.1038/s41598-018-32572-2.

Ji, Y. et al. (2001). Amyloid beta40/42 clearance across the blood-brain barrier following intra-ventricular injections in wild-type, apoE knock-out and human apoE3 or E4 expressing transgenic mice. J. Alzheimer's Dis. 3(1), 23
     
  < Back