Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Pyr11]-beta-Amyloid (11-42), Human

Product Name [Pyr11] - beta - Amyloid (11 - 42), Human
Pyr - VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # AS-29903-1
US$ $484
Purity % Peak Area By HPLC ≥ 95%
Description

Aßs are generated by the proteolytic processing of the amyloid ß-precursor protein (APP). Subsequent cleavage by g-secretase gives rise to Aß (1-40/42) and Aß (11-40/42). Aß (11-40) and Aß (11-42) are major Aß cleavage products generated by BACE.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Liu, K. et al. Biochem. 41, 3128 (2002).
Molecular Weight 3317.9
Sequence
(One-Letter Code)
Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
Pyr - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations D'Arrigo, C. et al. (2009). N‐terminal truncated pyroglutamyl β amyloid peptide Aβpy3‐42 shows a faster aggregation kinetics than the full‐length Aβ1‐42. Biopolymers 91, 861. doi: 10.1002/bip.21271.

Feld, M. et al. (2008). Effect on memory of acute administration of naturally secreted fibrils and synthetic amyloid-beta peptides in an invertebrate model. Neurobiol Learn Mem 89, 407. doi: 10.1016/j.nlm.2007.08.011.

Piccini, A. et al. (2005). β-Amyloid is different in normal aging and in Alzheimer disease. J. Biol. Chem. 280, 34186. doi: 10.1074/jbc.M501694200.
     
  < Back