Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (42-1), Human

Product Name Beta - Amyloid (42 - 1), Human
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Size 0.5 mg
Catalog # AS-27275
US$ $363
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 4514.1
Sequence
(One-Letter Code)
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Sequence
(Three-Letter Code)
H - Ala - Ile - Val - Val - Gly - Gly - Val - Met - Leu - Gly - Ile - Ile - Ala - Gly - Lys - Asn - Ser - Gly - Val - Asp - Glu - Ala - Phe - Phe - Val - Leu - Lys - Gln - His - His - Val - Glu - Tyr - Gly - Ser - Asp - His - Arg - Phe - Glu - Ala - Asp - OH
Product Citations Li, W. et al. (2011). Regulation of matrix metalloproteinase 2 by oligomeric amyloid β protein. Brain Res 10.1016/j.brainres.2011.02.078.

Libeu, CP. et al. (2011). Structural and functional alterations in amyloid-β precursor protein induced by amyloid-β peptides. J Alzheimer's Dis 25, 547.

Klaver, A. et al. (2010). Measurement of anti-Aβ1–42 antibodies in intravenous immunoglobulin with indirect ELISA: The problem of nonspecific binding. J Neurosci Methods 187, 263.

Tran, T. et al. (2010). Chronic psychosocial stress accelerates impairment of long-term memory and late-phase long-term potentiation in an at-risk model of Alzheimer's disease. Hippocampus 10.1002/hipo.20790.

Chafekar, SM. et al. (2007). Aβ 1-42 induces mild endoplasmic reticulum stress in an aggregation state-dependent manner. Antioxid Redox Signaling 9, 2245.

Xiong, K. et al. (2007). Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp Brain Res 181, 435.

Widenbrant, MJO. et al. (2006). Lipid-induced β-amyloid peptide assemblage fragmentation. Biophys J 91, 4071.

Boyd-Kimball, D. et al. (2005). Proteomic identification of proteins oxidized by Aβ(1–42) in synaptosomes: Implications for Alzheimer's disease. Brain Res 1044, 206.
     
  < Back