Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Antimicrobial and Related Peptides  >>  Cecropin A

Product Name Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
Size 1 mg
Catalog # AS-24010
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Description

Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 4003.8
Sequence
(One-Letter Code)
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Sequence
(Three-Letter Code)
H - Lys - Trp - Lys - Leu - Phe - Lys - Lys - Ile - Glu - Lys - Val - Gly - Gln - Asn - Ile - Arg - Asp - Gly - Ile - Ile - Lys - Ala - Gly - Pro - Ala - Val - Ala - Val - Val - Gly - Gln - Ala - Thr - Gln - Ile - Ala - Lys - NH2
Product Citations Yu, G. et al. (2016). Combination effects of antimicrobial peptides Antimicrob Agents Chemother doi: 10.1128/AAC02434-15.

McGrath, D. et al. (2013). Mechanism of action and initial evaluation of a membrane active all-D-enantiomer antimicrobial peptidomimetic. PNAS 110, 3477. doi: 10.1073/pnas.1221924110.

Kulagina, NV. et al. (2007). Antimicrobial peptides as new recognition molecules for screening challenging species. Sens Actuators B Chem. 121, 150. doi: 10.1016/j.snb.2006.09.044.
     
  < Back