Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  ACTH and Related Peptides  >>  ACTH (1-39), human

Product Name ACTH (1 - 39), human
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Size 0.5 mg
Catalog # AS-20610
US$ $127
Purity % Peak Area By HPLC ≥ 95%
Description

Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed. ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Stewart, PM. et al. Clin Endocrinol 40, 199 (1994)
Elias, LL. and AJ. Clark, Braz J Med Biol Res 33, 1245 (2000)
Latronico, AC. Braz J Med Biol Res 33, 1249 (2000)
Molecular Weight 4541.1
Sequence
(One-Letter Code)
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence
(Three-Letter Code)
H - Ser - Tyr - Ser - Met - Glu - His - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - Phe - OH
     
  < Back