Login

Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides > Amyloid Peptides > Islet Amyloid Polypeptides (IAPP) >> Amylin (1-37), rat, mouse

Product Name	Amylin (1 - 37), rat, mouse KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
Size	1 mg
Catalog #	AS-60253-1
US$	$479
Purity	% Peak Area By HPLC ≥ 95%
Description	Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Detailed Information	Datasheet Material Safety Data Sheets (MSDS)
Storage	-20°C
References	Westermark, P. et al. Proc Natl Acad Sci U S A 87, 5036 (1990); Williamson, JA. and AD. Miranker. Protein Sci 16, 110 (2007). doi: 10.1110/ps.062486907.
Molecular Weight	3920.5
Sequence (One-Letter Code)	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
Sequence (Three-Letter Code)	H - Lys - Cys - Asn - Thr - Ala - Thr - Cys - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2 (Disulfide bridge: 2 - 7)
Product Citations	Junghans A, et al. (2016). Influence of the Human and Rat Islet Amyloid Polypeptides on Structure of Phospholipid Bilayers: Neutron Reflectometry and Fluorescence Microscopy Studies. Langmuir. 32(17):4382-91. doi: 10.1021/acs.langmuir.6b00825.

Copyright © 2002-2019 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530