Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Assay Kits  >  Alzheimer's and Parkinson's Disease  >>  AggreSureᵀᴹ β-Amyloid (1-40), human

Product Name AggreSureᵀᴹ β - Amyloid (1 - 40), human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.25 mg NET peptide
Catalog # AS-72215
US$ $263
Purity >95%
Description

AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using SensoLyte® ThT Aβ40 Aggregation kit (Cat# 72213). Aggregation is guaranteed.

AS-72215 fig. 1

Figure 1. An increase of fluorescence signal is correlated with an increase of Aβ40 fibril formation. Phenol Red, 0-Vanillin, Dopamine, and Tannic Acid were added at 50 μM final concentration to inhibit Aβ40 aggregation. Fluorescence signal was monitored at Ex/Em= 440/484 nm every 5 minutes at 37ºC with 15 seconds shaking between reads (SpectraMax M5e fluorimeter, Molecular Devices).
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage –20°C
Molecular Weight 4329.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Maneshi, MM. et al. (2018). Enantiomeric Aβ peptides inhibit the fluid shear stress response of PIEZO1. Sci Rep 8(1):14267. doi: 10.1038/s41598-018-32572-2.

Hartz. AM, et al. (2016). Aβ40 Reduces P-Glycoprotein at the Blood-Brain Barrier through the Ubiquitin-Proteasome Pathway. J Neurosci. 36(6):1930-41. doi:10.1523/JNEUROSCI.0350-15.2016.

Debner EK & King JM. (2016). Effects of Melatonin and Beta-Amyloid on Mitochondrial Function in a Model of Aging Mouse Astrocytes. The FASEB J 30(1_supplement):702-1.

Truman, A. et al. (2014) Beta-Amyloid fibril detection by Thioflavin T fluorescence on the GloMax®-Multi+ detection system with Instinct® software. Promega Corporation Web site.
     
  < Back