Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  HNP-1, Defensin Human Neutrophil Peptide-1

Product Name HNP - 1, Defensin Human Neutrophil Peptide - 1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
Size 0.1 mg
Catalog # AS-60743
US$ $198
Purity % Peak Area By HPLC ≥ 95%
Description

Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Frick, I. et al. J. Biol. Chem. 278, 16561 (2003); Valore, E. at al. J. Clin. Invest. 97, 1624 (1996); Mizukawa, N. et al. Anticancer Res. 20, 1125 (2000); Bastian, A. and H. Schafer, Regul Pept. 101, 157 (2001).
Molecular Weight 3442.1
Sequence
(One-Letter Code)
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
Sequence
(Three-Letter Code)
H - Ala - Cys - Tyr - Cys - Arg - Ile - Pro - Ala - Cys - Ile - Ala - Gly - Glu - Arg - Arg - Tyr - Gly - Thr - Cys - Ile - Tyr - Gln - Gly - Arg - Leu - Trp - Ala - Phe - Cys - Cys - OH (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
Product Citations Hou, S. et al. (2015). Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37 ASM 83 doi: 10.1128/IAI.00746-15

Swidergall, M. et al. (2013). Candida albicans mucin Msb2 Is a broad-tange protectant against antimicrobial peptides. Antimicrob Agents Chemother 57, 3917. doi: 10.1128/AAC.00862-13.

Vega, LA. et al. (2012). Cationic antimicrobial peptides disrupt the Streptococcus pyogenes ExPortal. Mol Microbiol 85, 1119. doi: 10.1111/j.1365-2958.2012.08163.x (2012).

Laing, S. et al. (2011). Strategies for the identification of arginine ADP-ribosylation sites. J Proteomics 75, 169.
     
  < Back