Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  Chlorotoxin (Cltx) 

Product Name Chlorotoxin (Cltx) 
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Size 0.1 mg
Catalog # AS-60770
US$ $115
Purity % Peak Area By HPLC ≥ 95%
Description

A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).
Molecular Weight 3996
Sequence
(One-Letter Code)
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Sequence
(Three-Letter Code)
H - Met - Cys - Met - Pro - Cys - Phe - Thr - Thr - Asp - His - Gln - Met - Ala - Arg - Lys - Cys - Asp - Asp - Cys - Cys - Gly - Gly - Lys - Gly - Arg - Gly - Lys - Cys - Tyr - Gly - Pro - Gln - Cys - Leu - Cys - Arg - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Product Citations Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.

Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.

Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.

Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.

Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104.

Meng, X. et al. Acta Pharmacol. Sinica 28, 2019 (2006).
     
  < Back