Login

Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides > Cyclic Peptides > Disulfide Cyclized Peptides >> Chlorotoxin (Cltx)

Product Name	Chlorotoxin (Cltx) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Size	0.1 mg
Catalog #	AS-60770
US$	$115
Purity	% Peak Area By HPLC ≥ 95%
Description	A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Detailed Information	Datasheet Material Safety Data Sheets (MSDS)
Storage	-20°C
References	Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).
Molecular Weight	3996
Sequence (One-Letter Code)	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Sequence (Three-Letter Code)	H - Met - Cys - Met - Pro - Cys - Phe - Thr - Thr - Asp - His - Gln - Met - Ala - Arg - Lys - Cys - Asp - Asp - Cys - Cys - Gly - Gly - Lys - Gly - Arg - Gly - Lys - Cys - Tyr - Gly - Pro - Gln - Cys - Leu - Cys - Arg - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)
Product Citations	Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104. Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104. Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104. Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104. Wan, J. et al. (2010). Incorporation of magnetite nanoparticle clusters in fluorescent silica nanoparticles for high-performance brain tumor delineation. Nanotechnololgy 21, 235104. Meng, X. et al. Acta Pharmacol. Sinica 28, 2019 (2006).

Copyright © 2002-2019 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530