Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  Iberiotoxin (IbTX)

Product Name Iberiotoxin (IbTX)
Pyr - FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: C7 - C28,C13 - C33,C17 - C35)
Size 0.1 mg
Catalog # AS-60763
US$ $159
Purity % Peak Area By HPLC ≥ 95%
Description

A 37-amino acid peptide from the scorpion, Buthus tamulus, having 68% homology with charybdotoxin. It is a selective inhibitor of the highly conductance calcium-activated (maxi-K) potassium channels.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Galvez, A. et al. J. Biol. Chem. 265, 11083 (1990). Candia, S. et al. Biophys. J. 63, 583 (1992).
Molecular Weight 4230.9
Sequence
(One-Letter Code)
Pyr-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: C7-C28,C13-C33,C17-C35)
Sequence
(Three-Letter Code)
Pyr - Phe - Thr - Asp - Val - Asp - Cys - Ser - Val - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Lys - Asp - Leu - Phe - Gly - Val - Asp - Arg - Gly - Lys - Cys - Met - Gly - Lys - Lys - Cys - Arg - Cys - Tyr - Gln - OH (Disulfide bridge: C7 - C28,C13 - C33,C17 - C35)
Product Citations Burke, M. et al. (2013). Genetic basis of the impaired renal myogenic response in FHH rats. Am J Physiol Renal Physiol 304, F565. doi: 10.​1152/​ajprenal.​00404.​2012.

Vang, A. et al. (2010). Activation of endothelial BKCa channels causes pulmonary vasodilation. Vas Pharmacol doi:10.1016/j.vph.2010.05.00.

Vang, A. et al. (2010). Activation of endothelial BKCa channels causes pulmonary vasodilation. Vas Pharmacol doi:10.1016/j.vph.2010.05.00.

Vang, A. et al. (2010). Activation of endothelial BKCa channels causes pulmonary vasodilation. Vas Pharmacol doi:10.1016/j.vph.2010.05.00.
     
  < Back