Login

Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides > Cyclic Peptides > Disulfide Cyclized Peptides >> Iberiotoxin (IbTX)

Product Name	Iberiotoxin (IbTX) Pyr - FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: C7 - C28,C13 - C33,C17 - C35)
Size	0.1 mg
Catalog #	AS-60763
US$	$159
Purity	% Peak Area By HPLC ≥ 95%
Description	A 37-amino acid peptide from the scorpion, Buthus tamulus, having 68% homology with charybdotoxin. It is a selective inhibitor of the highly conductance calcium-activated (maxi-K) potassium channels.
Detailed Information	Datasheet Material Safety Data Sheets (MSDS)
Storage	-20°C
References	Galvez, A. et al. J. Biol. Chem. 265, 11083 (1990). Candia, S. et al. Biophys. J. 63, 583 (1992).
Molecular Weight	4230.9
Sequence (One-Letter Code)	Pyr-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: C7-C28,C13-C33,C17-C35)
Sequence (Three-Letter Code)	Pyr - Phe - Thr - Asp - Val - Asp - Cys - Ser - Val - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Lys - Asp - Leu - Phe - Gly - Val - Asp - Arg - Gly - Lys - Cys - Met - Gly - Lys - Lys - Cys - Arg - Cys - Tyr - Gln - OH (Disulfide bridge: C7 - C28,C13 - C33,C17 - C35)
Product Citations	Burke, M. et al. (2013). Genetic basis of the impaired renal myogenic response in FHH rats. Am J Physiol Renal Physiol 304, F565. doi: 10.1152/ajprenal.00404.2012. Vang, A. et al. (2010). Activation of endothelial BKCa channels causes pulmonary vasodilation. Vas Pharmacol doi:10.1016/j.vph.2010.05.00. Vang, A. et al. (2010). Activation of endothelial BKCa channels causes pulmonary vasodilation. Vas Pharmacol doi:10.1016/j.vph.2010.05.00. Vang, A. et al. (2010). Activation of endothelial BKCa channels causes pulmonary vasodilation. Vas Pharmacol doi:10.1016/j.vph.2010.05.00.

Copyright © 2002-2019 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530