Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Diabetes Related Peptides  >>  GIP, rat

Product Name GIP, rat
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Size 0.5 mg
Catalog # AS-65568-05
US$ $198
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Molecular Weight 5002.95
Sequence
(One-Letter Code)
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Sequence
(Three-Letter Code)
Tyr - Ala - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - Arg - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Leu - Thr - Gln - OH
     
  < Back