GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Size
1 mg
Catalog #
AS-62068
US$
$297
Purity
% Peak Area By HPLC ≥ 95%
Description
Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Yusta, B. et al. J Biol Chem274, 30459 (1999) Drucker, D. Gastroenterol122, 531 (2002).
Molecular Weight
3922.4
Sequence (One-Letter Code)
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Sequence (Three-Letter Code)
H - His - Ala - Asp - Gly - Ser - Phe - Ser - Asp - Glu - Met - Asn - Thr - Ile - Leu - Asp - Asn - Leu - Ala - Ala - Arg - Asp - Phe - Ile - Asn - Trp - Leu - Ile - Gln - Thr - Lys - Ile - Thr - Asp - Arg - OH