Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Diabetes Related Peptides  >>  GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human

Product Name GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Size 1 mg
Catalog # AS-62068
US$ $297
Purity % Peak Area By HPLC ≥ 95%
Description

Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Yusta, B. et al. J Biol Chem 274, 30459 (1999)
Drucker, D. Gastroenterol 122, 531 (2002).
Molecular Weight 3922.4
Sequence
(One-Letter Code)
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Sequence
(Three-Letter Code)
H - His - Ala - Asp - Gly - Ser - Phe - Ser - Asp - Glu - Met - Asn - Thr - Ile - Leu - Asp - Asn - Leu - Ala - Ala - Arg - Asp - Phe - Ile - Asn - Trp - Leu - Ile - Gln - Thr - Lys - Ile - Thr - Asp - Arg - OH
     
  < Back