GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Brubaker, P. and D. Drucker, Receptors Channels8, 179 (2002) Leonova, J. et al. Am J Physiol Cell Physiol281, C1495 (2001) Drucker, D. et al. Proc Natl Acad Sci USA84, 3434 (1987) Rönnbäck, L. and E. Hansson, J Neuroinflamm1, 22 (2004) Rothstein, JD. et al. Neuron16, 675 (1996)
Molecular Weight
3355.7
Sequence (One-Letter Code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence (Three-Letter Code)
H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Gly - OH
Copyright © 2002-2019 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530
Material Safety Data Sheets (MSDS)
