Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Diabetes Related Peptides  >>  Exendin (9-39)
Product Name Exendin (9 - 39)
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 0.5 mg
Catalog # AS-24467
US$ $231
Purity % Peak Area By HPLC ≥ 95%
Description

This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Montrose-Rafizadeh, C. et al. J Biol Chem 272, 21201 (1997)
Eng, J. et al. J Biol Chem 267, 7402 (1992)
Greig, NH. et al. Diabetolog 42, 45 (1999)
Göke R. et al. J Biol Chem 268, 19650 (1993)
Molecular Weight 3369.8
Sequence
(One-Letter Code)		 DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)		 H - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back

  Copyright © 2002-2019 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530