Login

Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides > Diabetes Related Peptides >> Exendin 4

Product Name	Exendin 4 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size	1 mg
Catalog #	AS-24464
US$	$151
Purity	% Peak Area By HPLC ≥ 95%
Description	Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Detailed Information	Datasheet Material Safety Data Sheets (MSDS)
Storage	-20°C
References	Eng, J. et al. J Biol Chem 267, 7402 (1992) Greig, NH. et al. Diabetolog 42, 45 (1999) Göke R. et al. J Biol Chem 268, 19650 (1993)
Molecular Weight	4186.6
Sequence (One-Letter Code)	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence (Three-Letter Code)	H - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
Product Citations	Potthoff, MJ. et al. (2013). Colesevelam suppresses hepatic glycogenolysis by TGR5-mediated induction of GLP-1 action in DIO mice. Am J Physiol Gastrointest Liver Physiol 304, G371. doi: 10.1152/ajpgi.00400.2012. Ding, J. et al. (2009). Pax6 haploinsufficiency causes abnormal metabolic homeostasis by down-regulating GLP-1 in mice. Endocrin. doi:10.1210/en.2008-1006. Sordi, V. et al. (2009). Mesenchymal Cells Appearing in Pancreatic Tissue Culture Are Bone Marrow-Derived Stem Cells With the Capacity to Improve Transplanted Islet Function. Stemm Cells 28, 140. Sharma, A. et al. (2006). Exendin-4 treatment improves metabolic control after rat islet transplantation to athymic mice with streptozotocin-induced diabetes. Diabetologia 49, 1247.

Copyright © 2002-2019 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530