Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides
Efficient transfer of proteins or nucleic acids across cellular membranes is one of the major problems in cell biology. To deliver the functional domain of a selected protein from the outside to the inside of intact cells, a carrier is needed. Cell Permeable Peptides, also known as Protein Transduction Domains (PTDs), are carriers with small peptide domains that can freely cross cell membranes. Several PTDs have been identified that allow a fused protein to efficiently cross cell membranes in a process known as protein transduction. Studies have demonstrated that a TAT peptide derived from the HIV TAT protein has the ability to transduce peptides or proteins into various cells. PTDs have been utilized in anticancer strategy, for example, a cell permeable Bcl-2 binding peptide, cpm1285, shows activity in slowing human myeloid leukemia growth in mice. Cell-permeable phosphopeptides, such as FGFR730pY, which mimics receptor binding sites for specific SH2 domain-containing proteins are potential tools for cancer research and cell signaling mechanism studies.

Time-lapse video of FITC-LC-Antennapedia peptide (cat# 24175, 24176)
entry into a neuronal cluster of cells. Video courtesy of Dr. E. Gruenstein,
Univ. of Cincinnati Medical School, Cincinnati, OH.


Figure 1. Uptake of CPP by HeLa cells. HeLa cells were incubated with OptiMEM
medium containing 10 uM FITC-LC-Antennapedia, cat# 24175, 24176 (panel A) and
10 uM of TAMRA-labelled TAT (47-57), cat# 61211(B) for 1 h, washed and analyzed
by fluorescence microscopy.
Ref: Embury, J. et al. Diabetes 50, 1706 (2001), Wang, H. et al. J. Clin. Invest. 109, 1463 (2002); Lin, Y-Z. J. Biol. Chem. 270, 14255 (1995); Holzberg, D. et al. J. Biol. Chem. 278, 40213 (2003); Williams, E. et al. J. Biol. Chem. 272, 22349 (1997); Nakatani, KH. et al. Nat. Med. 10, 1128 (2004); Mortlock, A. et al. Nucleic Acids Res. 31, e152 (2003); Kaneto, H. et al. Nat. Med. 10, 1128 (2004); Wang, JL. et al. Cancer Res. 60, 1498 (2000); Oess S. and E. Hildt, Gene. Ther. 7, 750 (2000); Dunican, D. et al. Cell Growth Diff. 12, 255 (2001).

 Product Size Catalog # US$  
(Arg)9
RRRRRRRRR
1 mg AS-61204 $61
(Arg)9 biotin labeled
Biotin - LC - RRRRRRRRR - NH2
1 mg AS-64078 $105
(Arg)9, FAM - labeled
FAM - RRRRRRRRR
1 mg AS-61207 $242
(Arg)9, TAMRA - labeled
TAMRA - RRRRRRRRR
1 mg AS-61208 $264
Aminopeptidase N Ligand (CD13), NGR peptide
CNGRCG (Disulfide bridge: 1 - 5)
5 mg AS-60171-5 $484
Antennapedia Peptide, acid
RQIKIWFQNRRMKWKK
1 mg AS-61032 $99
Antennapedia Peptide, FAM - labeled
5 - FAM - RQIKIWFQNRRMKWKK - NH2
1 mg AS-64212 $242
Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
0.5 mg AS-24177 $242
Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
1 mg AS-24178 $435
Biotin - TAT (47 - 57)
Biotin - YGRKKRRQRRR
1 mg AS-61209 $115
Buforin
TRSSRAGLQFPVGRVHRLLRK
1 mg AS-61255 $176
Chimeric Rabies Virus Glycoprotein Fragment (RVG - 9R)
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
1 mg AS-62565 $484
Cys(Npys) Antennapedia Peptide, amide
C(Npys) - RQIKIWFQNRRMKWKK - NH2
1 mg AS-61034 $143
Cys(Npys) - (Arg)9
C(Npys)RRRRRRRRR - NH2
1 mg AS-61205 $242
Cys(Npys) - (D - Arg)9
C(Npys)rrrrrrrrr - NH2
1 mg AS-61206 $291
Cys(Npys) - TAT (47 - 57)
C(Npys)YGRKKRRQRRR - NH2
1 mg AS-61214 $242
Cys(Npys) - TAT (47 - 57), FAM - labeled
C(Npys)YGRKKRRQRRR - K(FAM) - NH2
1 mg AS-61213 $291
Cys - TAT (47 - 57)
CYGRKKRRQRRR - NH2
1 mg AS-61212 $99
FITC - LC - Antennapedia Peptide
FITC - LC - RQIKIWFQNRRMKWKK - NH2
0.5 mg AS-24175 $154
FITC - LC - Antennapedia Peptide
FITC - LC - RQIKIWFQNRRMKWKK - NH2
1 mg AS-24176 $242
FITC - LC - TAT (47 - 57)
FITC - LC - YGRKKRRQRRR - NH2
0.5 mg AS-27042 $154
FITC - LC - TAT (47 - 57)
FITC - LC - YGRKKRRQRRR - NH2
1 mg AS-27043 $242
HIV - 1 Tat (48 - 60)
GRKKRRQRRRPPQ
1 mg AS-63847 $83
KALA
WEAKLAKALAKALAKHLAKALAKALKACEA
1 mg AS-65459 $195
Mastoparan
INLKALAALAKKIL - NH2
1 mg AS-24270 $49
Mastoparan
INLKALAALAKKIL - NH2
5 mg AS-24269 $193
NGR Peptide 1
CNGRCGGklaklakklaklak - NH2 (Disulfide bridge: 1 - 5)
1 mg AS-60189-1 $237
Penetratin
RQIKIWFQNRRMKWKKGG
1 mg AS-64885 $99
Penetratin - Arg
RQIRIWFQNRRMRWRR
1 mg AS-65464 $110
Pep - 1 - Cysteamine
Ac - KETWWETWWTEWSQPKKKRKV - cysteamine
1 mg AS-63849 $193
Pep - 1: Chariot (Non - Covalent Delivery of Peptides and Proteins)
KETWWETWWTEWSQPKKKRKV
1 mg AS-61253 $176
pVEC (Cadherin - 5)
LLIILRRRIRKQAHAHSK
1 mg AS-65465 $110
Rabies Virus Glycoprotein (RVG)
YTIWMPENPRPGTPCDIFTNSRGKRASNG
1 mg AS-62566 $225
SV - 40 Large T - antigen Nuclear Localization Signal (NLS)
CGGGPKKKRKVED
1 mg AS-63831 $77
SV40 T - Ag - derived Nuclear Localization Signal (NLS) Peptide
PKKKRKVEDPYC
1 mg AS-63788 $83
TAT (47 - 57)
YGRKKRRQRRR
1 mg AS-60023-1 $93
TAT (47 - 57)
YGRKKRRQRRR
5 mg AS-60023-5 $363
TAT (47 - 57) GGG - Cys(Npys)
YGRKKRRQRRRGGG - C(Npys) - NH2
1 mg AS-61215 $242
TAT (47 - 57), FAM - labeled
FAM - YGRKKRRQRRR
1 mg AS-61210 $203
TAT (47 - 57), TAMRA - labeled
TAMRA - YGRKKRRQRRR
1 mg AS-61211 $231
Tat - Beclin - 1
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
1 mg AS-65467 $195
Tat - Beclin - 1, scrambled
YGRKKRRQRRRGGVGNDFFINHETTGFATEW
1 mg AS-65468 $195
Tat - C (48 - 57)
CGRKKRRQRRR
1 mg AS-62063 $66
TAT - GluR23A Fusion Peptide
YGRKKRRQRRRAKEGANVAG
1 mg AS-64984 $110
Tat - GluR23Y
YGRKKRRQRRRYKEGYNVYG
1 mg AS-64429 $110
Tat - GluR23Y, scrambled
YGRKKRRQRRRVYKYGGYNE
1 mg AS-64428 $110
TAT - HA2 Fusion Peptide
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
1 mg AS-64876 $215
Tat - NR2Bct
YGRKKRRQRRRKLSSIESDV
1 mg AS-62042 $237
TAT - NSF222 Fusion Peptide
YGRKKRRQRRR - GGG - LDKEFNSIFRRAFASRVFPPE
1 mg AS-62240 $313
TAT - NSF222scr Fusion Polypeptide, scrambled
YGRKKRRQRRR - GGG - ENSFRFLADIFPAKAFPVRFE
1 mg AS-62210 $308
TAT - NSF700 Fusion Peptide
YGRKKRRQRRR - GGG - LLDYVPIGPRFSNLVLQALLVL
1 mg AS-62238 $325
TAT - NSF700scr
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
1 mg AS-62209 $308
TfR Targeting Peptide
THRPPMWSPVWP
1 mg AS-64689 $66
Transdermal Peptide
ACSSSPSKHCG
1 mg AS-62066 $61
Transportan
GWTLNSAGYLLGKINLKALAALAKKIL
1 mg AS-61256 $237
  < Back