Peptides  >  Antimicrobial and Related Peptides
Cationic antimicrobial peptides are important components of the innate defenses of all species. More than 100 of these peptides have been identified in numerous organisms, including fungi, insects, amphibians and humans. These hydrophobic and amphipathic peptides exhibit antibiotic, fungicidal, hemolytic, virucidal, and tumoricidal activities. Based on their structural properties, these antimicrobial peptides can be grouped into three classes, peptides that are helicoidal, peptides containing one to several disulfide bridges and peptides rich in certain amino acids such as proline or tryptophan. Most of these peptides share some common characteristics, such as their low molecular mass (2–5 kDa), the presence of multiple lysine and arginine residues and an amphipathic nature. Although the exact mechanism by which they kill bacteria is not clearly understood, it has been shown that peptide–lipid interactions leading to membrane permeation play a role in their activity. Examples of antibiotic peptides include magainins, secreted by the skin of Xenopus laevis; defensins from the human neutrophils and histatins from human saliva. Cecropins are produced by insects under conditions of infections. Cecropins A, B, and D are close homologues consisting of 35-39 residues found in the pupae of the cecropin moth.
Ref: Won, H. et al. Eur. J. Biochem. 269, 4367 (2002); Hancock, REW. and MG. Scott, Proc. Natl. Acad. Sci. USA 97, 8856 (2000); Andreu, D. et al. Proc. Natl. Acad. Sci. USA 80, 6475 (1983); M. Vaara and T. Vaara, Antimicrob. Agents Chemo. 38, 2498 (1994); Vizioli J. et al. Insect. Mol. Biol. 9, 75 (2000); Silvestro, L. et al. Antimicrob. Agents Chemo. 44, 602 (2000); Helmerhorst, E. et al. J. Biol. Chem. 274, 7286 (1999).
 Product Size Catalog # US$  
5 - FAM - LC - LL - 37
5 - FAM - LC - [LL-37, 37 aa]
0.1 mg AS-63694 $139
Apidaecin IB
GNNRPVYIPQPRPPHPRL
1 mg AS-62044 $113
Bac2A; Bactenecin 2A
RLARIVVIRVAR - NH2
1 mg AS-64906 $73
Biotin - LC - LL - 37
Biotin - LC - [LL-37, 37 aa]
0.5 mg AS-63693 $306
BMAP - 18  NEW
GRFKRFRKKFKKLFKKLS
1 mg AS-65597 $147
BMAP - 27  NEW
GRFKRFRKKFKKLFKKLSPVIPLLHLG
1 mg AS-65598 $205
CAP - 18, rabbit
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
0.5 mg AS-61307 $238
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
0.5 mg AS-24009 $181
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
1 mg AS-24010 $300
Cecropin B
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2
0.5 mg AS-24011 $181
CSP - 2, Competence - Stimulating Peptide - 2
EMRISRIILDFLFLRKK
1 mg AS-63877 $108
Cys - LC - LL - 37
C - LC - [LL-37, 37 aa]
1 mg AS-63692 $306
Dermcidin, DCD - 1L
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
0.1 mg AS-63713 $147
Drosocin
GKPRPYSPRPTSHPRPIRV
1 mg AS-62600 $118
Elafin
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
0.1 mg AS-61641 $244
HEL (46 - 61)
NTDGSTDYGILQINSR
1 mg AS-60504-1 $147
Histatin - 5
DSHAKRHHGYKRKFHEKHHSHRGY
1 mg AS-61001 $199
Human Lactotransferrin (37 - 61), Lactoferricin H
TKCFQWQRNMRKVR - G - PPVSCIKRDS (Disulfide between Cys3 and Cys20)
1 mg AS-64074 $238
Human Platelet Factor IV 18, C18G
ALYKKLLKKLLKSAKKLG
1 mg AS-62412 $113
Indolicidin
ILPWKWPWWPWRR - NH2
1 mg AS-60999 $147
Lactoferricin B, Lactoferrin (17 - 41)
FKCRRWQWRMKKLGAPSITCVRRAF (S - S BOND)
1 mg AS-62651 $204
LEAP - 1, Hepcidin, human
DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7 - 23, 10 - 13, 11 - 19, 14 - 22)
0.1 mg AS-61432 $221
LL - 37 fragment (18 - 37), LL - 18 - 37
KRIVQRIKDFLRNLVPRTES
1 mg AS-63712 $127
LL - 37, Antimicrobial Peptide, human
[LL-37, 37 aa]
1 mg AS-61302 $188
LL - 37, reverse sequence
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
0.5 mg AS-62208 $150
LL - 37, scrambled
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
1 mg AS-63708 $318
LL17 - 29
FKRIVQRIKDFLR
5 mg AS-65454-5 $158
LL17 - 32
FKRIVQRIKDFLRNLV
1 mg AS-65452-1 $73
LL17 - 32
FKRIVQRIKDFLRNLV
5 mg AS-65452-5 $158
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
0.5 mg AS-20791 $102
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
1 mg AS-20792 $147
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
0.5 mg AS-20639 $102
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
1 mg AS-20640 $147
mCRAMP, mouse
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
1 mg AS-61305 $283
Melittin, honey bee
GIGAVLKVLTTGLPALISWIKRKRQQ - NH2
1 mg AS-62366 $186
NRC - 16  NEW
GWKKWLRKGAKHLGQAAIK
1 mg AS-65593 $147
PMAP - 23  NEW
RIIDLLWRVRRPQKPKFVTVWVR
1 mg AS-65596 $201
Protegrine - 1 (PG - 1), amide
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
1 mg AS-64819-1 $561
Protegrine - 1 (PG - 1), amide
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
0.5 mg AS-64819-05 $322
Pyrrhocoricin
VDKGSYLPRPTPPRPIYNRN
1 mg AS-62601 $125
rCRAMP
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
0.5 mg AS-61306 $238
Rev4  NEW
RRWPWWPWKWPLI
1 mg AS-65594 $113
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29
RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
1 mg AS-61308 $238
SMAP - 18  NEW
RGLRRLGRKIAHGVKKYG - NH2
1 mg AS-65595 $147
Temporin A, amide
FLPLIGRVLSGIL - NH2
1 mg AS-64831 $85
Temporin L, amide
FVQWFSKFLGRIL - NH2
1 mg AS-64836 $85
Tet - 20  NEW
KRWRIRVRVIRKC
1 mg AS-65592 $113
  < Back