The defensins are a large family of small, cationic, cysteine- and arginine-rich antimicrobial peptides. They are divided into five groups according to the spacing pattern of cysteines: plant, invertebrate, α-, β-, and θ-defensins. The latter three are mostly found in mammals. a-defensins are proteins found in neutrophils and intestinal epithelia. Human neutrophil peptides (HNP) 1-3 are microbicidal and cytotoxic defensins derived from a 94-amino acid prepro HNP1-94, co-translationally proteolyzed to proHNP20-94, then converted by removal of the anionic propiece to mature HNP65-94 (HNP-1 and -3) and HNP66-94 (HNP-2). HNP 1-4 make up approximately 5% of the total cellular protein of neutrophils. Ref: Xiao, Y. et al. BMC Genomics. 5, 56 (2004); Valore, E. et al. J. Clin. Invest. 97, 1624 (1996); Belvin, CL. et al. Gut. 45, 911 (1999).
| |
Product |
Size |
Catalog # |
US$ |
|
CHRG01; Human β - Defensin 3 (hBD3) Derivative KSSTRGRKSSRRKK |
1 mg |
AS-64886 |
$77 |
  |
hBD - 1, β - Defensin - 1, human DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35) |
0.1 mg |
AS-60740 |
$303 |
  |
hBD - 3, β - Defensin - 3, human GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11 - 40, 18 - 33, 23 - 41) |
0.1 mg |
AS-60741 |
$303 |
  |
HNP - 1, Defensin Human Neutrophil Peptide - 1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29) |
0.1 mg |
AS-60743 |
$198 |
  |
HNP - 2, Defensin Human Neutrophil Peptide - 2 CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1 - 29, 3 - 18, 8 - 28) |
0.1 mg |
AS-60744 |
$215 |
  |
|